Next: Brief Overview [Contents][Index]
This manual is for GNU Gnulib (updated 2018-07-19 15:11:38), which is a library of common routines intended to be shared at the source level.
Copyright © 2004–2018 Free Software Foundation, Inc.
Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled “GNU Free Documentation License”.
gettextize and autopoint usersFD_CLRFD_ISSETFD_SETFD_ZERO_Exit_exit_longjmp_setjmp_tolower_touppera64labortabsacceptaccessacosacosfacoshacoshfacoshlacoslaio_cancelaio_erroraio_fsyncaio_readaio_returnaio_suspendaio_writealarmaligned_allocalphasortasctimeasctime_rasinasinfasinhasinhfasinhlasinlassertatanatan2atan2fatan2latanfatanhatanhfatanhlatanlatexitatofatoiatolatollbasenamebindbsearchbtowcc16rtombc32rtombcabscabsfcabslcacoscacosfcacoshcacoshfcacoshlcacoslcalloccargcargfcarglcasincasinfcasinhcasinhfcasinhlcasinlcatancatanfcatanhcatanhfcatanhlcatanlcatclosecatgetscatopencbrtcbrtfcbrtlccosccosfccoshccoshfccoshlccoslceilceilfceillcexpcexpfcexplcfgetispeedcfgetospeedcfsetispeedcfsetospeedchdirchmodchowncimagcimagfcimaglclearerrclockclock_getcpuclockidclock_getresclock_gettimeclock_nanosleepclock_settimeclogclogfcloglcloseclosedircloselogconfstrconjconjfconjlconnectcopysigncopysignfcopysignlcoscosfcoshcoshfcoshlcoslcpowcpowfcpowlcprojcprojfcprojlcrealcrealfcreallcreatcryptcsincsinfcsinhcsinhfcsinhlcsinlcsqrtcsqrtfcsqrtlctanctanfctanhctanhfctanhlctanlctermidctimectime_rdaylightdbm_clearerrdbm_closedbm_deletedbm_errordbm_fetchdbm_firstkeydbm_nextkeydbm_opendbm_storedifftimedirfddirnamedivdlclosedlerrordlopendlsymdprintfdrand48dupdup2duplocaleencryptendgrentendhostentendnetentendprotoentendpwentendserventendutxentenvironerand48erferfcerfcferfclerfferflerrnoexeclexecleexeclpexecvexecveexecvpexitexpexp2exp2fexp2lexpfexplexpm1expm1fexpm1lfabsfabsffabslfaccessatfattachfchdirfchmodfchmodatfchownfchownatfclosefcntlfdatasyncfdetachfdimfdimffdimlfdopenfdopendirfeclearexceptfegetenvfegetexceptflagfegetroundfeholdexceptfeofferaiseexceptferrorfesetenvfesetexceptflagfesetroundfetestexceptfeupdateenvfexecvefflushffsfgetcfgetposfgetsfgetwcfgetwsfilenoflockfilefloorfloorffloorlfmafmaffmalfmaxfmaxffmaxlfmemopenfminfminffminlfmodfmodffmodlfmtmsgfnmatchfopenforkfpathconffpclassifyfprintffputcfputsfputwcfputwsfreadfreefreeaddrinfofreelocalefreopenfrexpfrexpffrexplfscanffseekfseekofsetposfstatfstatatfstatvfsfsyncftellftelloftokftruncateftrylockfileftwfunlockfilefutimensfwidefwprintffwritefwscanfgai_strerrorgetaddrinfogetcgetc_unlockedgetchargetchar_unlockedgetcwdgetdategetdate_errgetdelimgetegidgetenvgeteuidgetgidgetgrentgetgrgidgetgrgid_rgetgrnamgetgrnam_rgetgroupsgethostentgethostidgethostnamegetitimergetlinegetlogingetlogin_rgetmsggetnameinfogetnetbyaddrgetnetbynamegetnetentgetoptgetpeernamegetpgidgetpgrpgetpidgetpmsggetppidgetprioritygetprotobynamegetprotobynumbergetprotoentgetpwentgetpwnamgetpwnam_rgetpwuidgetpwuid_rgetrlimitgetrusagegetsgetservbynamegetservbyportgetserventgetsidgetsocknamegetsockoptgetsuboptgettimeofdaygetuidgetutxentgetutxidgetutxlinegetwcgetwcharglobglobfreegmtimegmtime_rgrantpthcreatehdestroyhsearchhtonlhtonshypothypotfhypotliconviconv_closeiconv_openif_freenameindexif_indextonameif_nameindexif_nametoindexilogbilogbfilogblimaxabsimaxdivinet_addrinet_ntoainet_ntopinet_ptoninitstateinsqueioctlisalnumisalnum_lisalphaisalpha_lisasciiisastreamisattyisblankisblank_liscntrliscntrl_lisdigitisdigit_lisfiniteisgraphisgraph_lisgreaterisgreaterequalisinfislessislessequalislessgreaterislowerislower_lisnanisnormalisprintisprint_lispunctispunct_lisspaceisspace_lisunorderedisupperisupper_liswalnumiswalnum_liswalphaiswalpha_liswblankiswblank_liswcntrliswcntrl_liswctypeiswctype_liswdigitiswdigit_liswgraphiswgraph_liswloweriswlower_liswprintiswprint_liswpunctiswpunct_liswspaceiswspace_liswupperiswupper_liswxdigitiswxdigit_lisxdigitisxdigit_lj0j1jnjrand48killkillpgl64alabslchownlcong48ldexpldexpfldexplldivlfindlgammalgammaflgammallinklinkatlio_listiolistenllabslldivllrintllrintfllrintlllroundllroundfllroundllocaleconvlocaltimelocaltime_rlockfloglog10log10flog10llog1plog1pflog1pllog2log2flog2llogblogbflogbllogflogllongjmplrand48lrintlrintflrintllroundlroundflroundllsearchlseeklstatmallocmblenmbrlenmbrtoc16mbrtoc32mbrtowcmbsinitmbsnrtowcsmbsrtowcsmbstowcsmbtowcmemccpymemchrmemcmpmemcpymemmovememsetmkdirmkdiratmkdtempmkfifomkfifoatmknodmknodatmkstempmktimemlockmlockallmmapmodfmodffmodflmprotectmq_closemq_getattrmq_notifymq_openmq_receivemq_sendmq_setattrmq_timedreceivemq_timedsendmq_unlinkmrand48msgctlmsggetmsgrcvmsgsndmsyncmunlockmunlockallmunmapnannanfnanlnanosleepnearbyintnearbyintfnearbyintlnewlocalenextafternextafterfnextafterlnexttowardnexttowardfnexttowardlnftwnicenl_langinfonl_langinfo_lnrand48ntohlntohsopenopenatopendiropenlogopen_memstreamopen_wmemstreamoptargopterroptindoptoptpathconfpausepcloseperrorpipepollpopenposix_fadviseposix_fallocateposix_madviseposix_mem_offsetposix_memalignposix_openptposix_spawnposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_addopenposix_spawn_file_actions_destroyposix_spawn_file_actions_initposix_spawnattr_destroyposix_spawnattr_getflagsposix_spawnattr_getpgroupposix_spawnattr_getschedparamposix_spawnattr_getschedpolicyposix_spawnattr_getsigdefaultposix_spawnattr_getsigmaskposix_spawnattr_initposix_spawnattr_setflagsposix_spawnattr_setpgroupposix_spawnattr_setschedparamposix_spawnattr_setschedpolicyposix_spawnattr_setsigdefaultposix_spawnattr_setsigmaskposix_spawnpposix_trace_attr_destroyposix_trace_attr_getclockresposix_trace_attr_getcreatetimeposix_trace_attr_getgenversionposix_trace_attr_getinheritedposix_trace_attr_getlogfullpolicyposix_trace_attr_getlogsizeposix_trace_attr_getmaxdatasizeposix_trace_attr_getmaxsystemeventsizeposix_trace_attr_getmaxusereventsizeposix_trace_attr_getnameposix_trace_attr_getstreamfullpolicyposix_trace_attr_getstreamsizeposix_trace_attr_initposix_trace_attr_setinheritedposix_trace_attr_setlogfullpolicyposix_trace_attr_setlogsizeposix_trace_attr_setmaxdatasizeposix_trace_attr_setnameposix_trace_attr_setstreamfullpolicyposix_trace_attr_setstreamsizeposix_trace_clearposix_trace_closeposix_trace_createposix_trace_create_withlogposix_trace_eventposix_trace_eventid_equalposix_trace_eventid_get_nameposix_trace_eventid_openposix_trace_eventset_addposix_trace_eventset_delposix_trace_eventset_emptyposix_trace_eventset_fillposix_trace_eventset_ismemberposix_trace_eventtypelist_getnext_idposix_trace_eventtypelist_rewindposix_trace_flushposix_trace_get_attrposix_trace_get_filterposix_trace_get_statusposix_trace_getnext_eventposix_trace_openposix_trace_rewindposix_trace_set_filterposix_trace_shutdownposix_trace_startposix_trace_stopposix_trace_timedgetnext_eventposix_trace_trid_eventid_openposix_trace_trygetnext_eventposix_typed_mem_get_infoposix_typed_mem_openpowpowfpowlpreadprintfpselectpsiginfopsignalpthread_atforkpthread_attr_destroypthread_attr_getdetachstatepthread_attr_getguardsizepthread_attr_getinheritschedpthread_attr_getschedparampthread_attr_getschedpolicypthread_attr_getscopepthread_attr_getstackpthread_attr_getstacksizepthread_attr_initpthread_attr_setdetachstatepthread_attr_setguardsizepthread_attr_setinheritschedpthread_attr_setschedparampthread_attr_setschedpolicypthread_attr_setscopepthread_attr_setstackpthread_attr_setstacksizepthread_barrier_destroypthread_barrier_initpthread_barrier_waitpthread_barrierattr_destroypthread_barrierattr_getpsharedpthread_barrierattr_initpthread_barrierattr_setpsharedpthread_cancelpthread_cleanup_poppthread_cleanup_pushpthread_cond_broadcastpthread_cond_destroypthread_cond_initpthread_cond_signalpthread_cond_timedwaitpthread_cond_waitpthread_condattr_destroypthread_condattr_getclockpthread_condattr_getpsharedpthread_condattr_initpthread_condattr_setclockpthread_condattr_setpsharedpthread_createpthread_detachpthread_equalpthread_exitpthread_getconcurrencypthread_getcpuclockidpthread_getschedparampthread_getspecificpthread_joinpthread_key_createpthread_key_deletepthread_killpthread_mutex_consistentpthread_mutex_destroypthread_mutex_getprioceilingpthread_mutex_initpthread_mutex_lockpthread_mutex_setprioceilingpthread_mutex_timedlockpthread_mutex_trylockpthread_mutex_unlockpthread_mutexattr_destroypthread_mutexattr_getprioceilingpthread_mutexattr_getprotocolpthread_mutexattr_getpsharedpthread_mutexattr_getrobustpthread_mutexattr_gettypepthread_mutexattr_initpthread_mutexattr_setprioceilingpthread_mutexattr_setprotocolpthread_mutexattr_setpsharedpthread_mutexattr_setrobustpthread_mutexattr_settypepthread_oncepthread_rwlock_destroypthread_rwlock_initpthread_rwlock_rdlockpthread_rwlock_timedrdlockpthread_rwlock_timedwrlockpthread_rwlock_tryrdlockpthread_rwlock_trywrlockpthread_rwlock_unlockpthread_rwlock_wrlockpthread_rwlockattr_destroypthread_rwlockattr_getpsharedpthread_rwlockattr_initpthread_rwlockattr_setpsharedpthread_selfpthread_setcancelstatepthread_setcanceltypepthread_setconcurrencypthread_setschedparampthread_setschedpriopthread_setspecificpthread_sigmaskpthread_spin_destroypthread_spin_initpthread_spin_lockpthread_spin_trylockpthread_spin_unlockpthread_testcancelptsnameputcputc_unlockedputcharputchar_unlockedputenvputmsgputpmsgputspututxlineputwcputwcharpwriteqsortquick_exitraiserandrand_rrandomreadreaddirreaddir_rreadlinkreadlinkatreadvreallocrealpathrecvrecvfromrecvmsgregcompregerrorregexecregfreeremainderremainderfremainderlremoveremqueremquoremquofremquolrenamerenameatrewindrewinddirrintrintfrintlrmdirroundroundfroundlscalblnscalblnfscalblnlscalbnscalbnfscalbnlscandirscanfsched_get_priority_maxsched_get_priority_minsched_getparamsched_getschedulersched_rr_get_intervalsched_setparamsched_setschedulersched_yieldseed48seekdirselectsem_closesem_destroysem_getvaluesem_initsem_opensem_postsem_timedwaitsem_trywaitsem_unlinksem_waitsemctlsemgetsemopsendsendmsgsendtosetbufsetegidsetenvseteuidsetgidsetgrentsethostentsetitimersetjmpsetkeysetlocalesetlogmasksetnetentsetpgidsetpgrpsetprioritysetprotoentsetpwentsetregidsetreuidsetrlimitsetserventsetsidsetsockoptsetstatesetuidsetutxentsetvbufshm_openshm_unlinkshmatshmctlshmdtshmgetshutdownsigactionsigaddsetsigaltstacksigdelsetsigemptysetsigfillsetsigholdsigignoresiginterruptsigismembersiglongjmpsignalsignbitsigngamsigpausesigpendingsigprocmasksigqueuesigrelsesigsetsigsetjmpsigsuspendsigtimedwaitsigwaitsigwaitinfosinsinfsinhsinhfsinhlsinlsleepsnprintfsockatmarksocketsocketpairsprintfsqrtsqrtfsqrtlsrandsrand48srandomsscanfstatstatvfsstderrstdinstdoutstpcpystpncpystrcasecmpstrcasecmp_lstrcatstrchrstrcmpstrcollstrcoll_lstrcpystrcspnstrdupstrerrorstrerror_lstrerror_rstrfmonstrfmon_lstrftimestrftime_lstrlenstrncasecmpstrncasecmp_lstrncatstrncmpstrncpystrndupstrnlenstrpbrkstrptimestrrchrstrsignalstrspnstrstrstrtodstrtofstrtoimaxstrtokstrtok_rstrtolstrtoldstrtollstrtoulstrtoullstrtoumaxstrxfrmstrxfrm_lswabswprintfswscanfsymlinksymlinkatsyncsysconfsyslogsystemtantanftanhtanhftanhltanltcdraintcflowtcflushtcgetattrtcgetpgrptcgetsidtcsendbreaktcsetattrtcsetpgrptdeletetelldirtempnamtfindtgammatgammaftgammaltimetimer_createtimer_deletetimer_getoverruntimer_gettimetimer_settimetimestimezonetmpfiletmpnamtoasciitolowertolower_ltouppertoupper_ltowctranstowctrans_ltowlowertowlower_ltowuppertowupper_ltrunctruncatetruncftruncltsearchttynamettyname_rtwalktznametzsetulimitumaskunameungetcungetwcunlinkunlinkatunlockptunsetenvuselocaleutimeutimensatutimesva_argva_copyva_endva_startvdprintfvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsnprintfvsprintfvsscanfvswprintfvswscanfvwprintfvwscanfwaitwaitidwaitpidwcpcpywcpncpywcrtombwcscasecmpwcscasecmp_lwcscatwcschrwcscmpwcscollwcscoll_lwcscpywcscspnwcsdupwcsftimewcslenwcsncasecmpwcsncasecmp_lwcsncatwcsncmpwcsncpywcsnlenwcsnrtombswcspbrkwcsrchrwcsrtombswcsspnwcsstrwcstodwcstofwcstoimaxwcstokwcstolwcstoldwcstollwcstombswcstoulwcstoullwcstoumaxwcswidthwcsxfrmwcsxfrm_lwctobwctombwctranswctrans_lwctypewctype_lwcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwordexpwordfreewprintfwritewritevwscanfy0y1ynbcmpbcopybsd_signalbzeroecvtfcvtftimegcvtgetcontextgethostbyaddrgethostbynamegetwdh_errnoindexmakecontextmktemppthread_attr_getstackaddrpthread_attr_setstackaddrrindexscalbsetcontextswapcontextualarmusleepvforkwcswcs<aio.h>
<aliases.h>
<argp.h>
<argz.h>
<arpa/inet.h>
<byteswap.h>
<complex.h>
<crypt.h>
<ctype.h>
<dirent.h>
<dlfcn.h>
<envz.h>
<err.h>
<errno.h>
<error.h>
<execinfo.h>
<fcntl.h>
<fenv.h>
<fmtmsg.h>
<fstab.h>
<fts.h>
<getopt.h>
<glob.h>
<gnu/libc-version.h>
<grp.h>
<gshadow.h>
<ifaddrs.h>
<libintl.h>
<link.h>
<malloc.h>
<math.h>
dremdremfdremlexp10exp10fexp10lfinitefiniteffinitelgammagammafgammalisinffisinflisnanfisnanlj0fj0lj1fj1ljnfjnllgamma_rlgammaf_rlgammal_rmatherrpow10pow10fpow10lscalbfscalblsignificandsignificandfsignificandlsincossincosfsincosly0fy0ly1fy1lynfynl<mcheck.h>
<mntent.h>
<netdb.h>
endnetgrentgethostbyaddr_rgethostbyname2gethostbyname2_rgethostbyname_rgethostent_rgetnetbyaddr_rgetnetbyname_rgetnetent_rgetnetgrentgetnetgrent_rgetprotobyname_rgetprotobynumber_rgetprotoent_rgetservbyname_rgetservbyport_rgetservent_rherrorhstrerrorinnetgrrcmdrcmd_afrexecrexec_afrresvportrresvport_afruserokruserok_afsetnetgrent<netinet/ether.h>
<netinet/in.h>
bindresvportgetipv4sourcefiltergetsourcefilterin6addr_anyin6addr_loopbackinet6_option_allocinet6_option_appendinet6_option_findinet6_option_initinet6_option_nextinet6_option_spaceinet6_opt_appendinet6_opt_findinet6_opt_finishinet6_opt_get_valinet6_opt_initinet6_opt_nextinet6_opt_set_valinet6_rth_addinet6_rth_getaddrinet6_rth_initinet6_rth_reverseinet6_rth_segmentsinet6_rth_spacesetipv4sourcefiltersetsourcefilter<obstack.h>
<printf.h>
<pthread.h>
pthread_attr_getaffinity_nppthread_attr_setaffinity_nppthread_getaffinity_nppthread_getattr_nppthread_getname_nppthread_kill_other_threads_nppthread_mutex_consistent_nppthread_mutexattr_getrobust_nppthread_mutexattr_setrobust_nppthread_rwlockattr_getkind_nppthread_rwlockattr_setkind_nppthread_setaffinity_nppthread_setname_nppthread_sigqueuepthread_timedjoin_nppthread_tryjoin_nppthread_yield<pty.h>
<pwd.h>
<regex.h>
<regexp.h>
<resolv.h>
<rpc/auth.h>
authdes_createauthdes_pk_createauthnone_createauthunix_createauthunix_create_defaultgetnetnamehost2netnamekey_decryptsessionkey_decryptsession_pkkey_encryptsessionkey_encryptsession_pkkey_gendeskey_get_convkey_secretkey_is_setkey_setsecretnetname2hostnetname2useruser2netnamexdr_des_blockxdr_opaque_auth<rpc/auth_des.h>
<rpc/auth_unix.h>
<rpc/clnt.h>
callrpcclnt_createclnt_pcreateerrorclnt_perrnoclnt_perrorclnt_spcreateerrorclnt_sperrnoclnt_sperrorclntraw_createclnttcp_createclntudp_bufcreateclntudp_createclntunix_createget_myaddressgetrpcportrpc_createerr<rpc/des_crypt.h>
<rpc/key_prot.h>
<rpc/netdb.h>
<rpc/pmap_clnt.h>
<rpc/pmap_prot.h>
<rpc/pmap_rmt.h>
<rpc/rpc_msg.h>
<rpc/svc.h>
svc_exitsvc_fdsetsvc_getreqsvc_getreq_commonsvc_getreq_pollsvc_getreqsetsvc_max_pollfdsvc_pollfdsvc_registersvc_runsvc_sendreplysvc_unregistersvcerr_authsvcerr_decodesvcerr_noprocsvcerr_noprogsvcerr_progverssvcerr_systemerrsvcerr_weakauthsvcraw_createsvctcp_createsvcudp_bufcreatesvcudp_createsvcunix_createxprt_registerxprt_unregister<rpc/xdr.h>
xdr_arrayxdr_boolxdr_bytesxdr_charxdr_doublexdr_enumxdr_floatxdr_freexdr_hyperxdr_intxdr_int16_txdr_int32_txdr_int64_txdr_int8_txdr_longxdr_longlong_txdr_netobjxdr_opaquexdr_pointerxdr_quad_txdr_referencexdr_shortxdr_sizeofxdr_stringxdr_u_charxdr_u_hyperxdr_u_intxdr_u_longxdr_u_longlong_txdr_u_quad_txdr_u_shortxdr_uint16_txdr_uint32_txdr_uint64_txdr_uint8_txdr_unionxdr_vectorxdr_voidxdr_wrapstringxdrmem_createxdrrec_createxdrrec_endofrecordxdrrec_eofxdrrec_skiprecordxdrstdio_create<rpcsvc/nislib.h>
nis_addnis_add_entrynis_addmembernis_checkpointnis_clone_objectnis_creategroupnis_destroy_objectnis_destroygroupnis_dir_cmpnis_domain_ofnis_domain_of_rnis_first_entrynis_freenamesnis_freeresultnis_freeservlistnis_freetagsnis_getnamesnis_getservlistnis_ismembernis_leaf_ofnis_leaf_of_rnis_lerrornis_listnis_local_directorynis_local_groupnis_local_hostnis_local_principalnis_lookupnis_mkdirnis_modifynis_modify_entrynis_name_ofnis_name_of_rnis_next_entrynis_perrornis_pingnis_print_directorynis_print_entrynis_print_groupnis_print_group_entrynis_print_linknis_print_objectnis_print_resultnis_print_rightsnis_print_tablenis_removenis_remove_entrynis_removemembernis_rmdirnis_servstatenis_sperrnonis_sperrornis_sperror_rnis_statsnis_verifygroup<rpcsvc/nis_callback.h>
<rpcsvc/yp.h>
xdr_domainnamexdr_keydatxdr_mapnamexdr_peernamexdr_valdatxdr_ypbind_bindingxdr_ypbind_respxdr_ypbind_resptypexdr_ypbind_setdomxdr_ypmap_parmsxdr_ypmaplistxdr_yppush_statusxdr_yppushresp_xfrxdr_ypreq_keyxdr_ypreq_nokeyxdr_ypreq_xfrxdr_ypresp_allxdr_ypresp_key_valxdr_ypresp_maplistxdr_ypresp_masterxdr_ypresp_orderxdr_ypresp_valxdr_ypresp_xfrxdr_ypstatxdr_ypxfrstat<rpcsvc/yp_prot.h>
<rpcsvc/ypclnt.h>
<rpcsvc/ypupd.h>
<sched.h>
<search.h>
<selinux/selinux.h>
<shadow.h>
<signal.h>
<stdio.h>
asprintfcuseridclearerr_unlockedfcloseallfeof_unlockedferror_unlockedfflush_unlockedfgetc_unlockedfgets_unlockedfileno_unlockedfopencookiefputc_unlockedfputs_unlockedfread_unlockedfwrite_unlockedgetwputwsetbuffersetlinebufsys_errlistsys_nerrtmpnam_rvasprintf<stdlib.h>
canonicalize_file_namecfreeclearenvdrand48_recvt_rerand48_rfcvt_rgetloadavggetptinitstate_rjrand48_rlcong48_rlrand48_rmkostempmkostempsmrand48_rmkstempsnrand48_ron_exitptsname_rqecvtqecvt_rqfcvtqfcvt_rqgcvtqsort_rrandom_rrpmatchsecure_getenvseed48_rsetstate_rsrand48_rsrandom_rstrtod_lstrtof_lstrtol_lstrtold_lstrtoll_lstrtoqstrtoul_lstrtoull_lstrtouqvalloc<string.h>
<sys/capability.h>
<sys/epoll.h>
<sys/fanotify.h>
<sys/file.h>
<sys/fsuid.h>
<sys/gmon.h>
<sys/io.h>, <sys/perm.h>
<sys/kdaemon.h>
<sys/klog.h>
<sys/mman.h>
<sys/mount.h>
<sys/personality.h>
<sys/prctl.h>
<sys/profil.h>
<sys/ptrace.h>
<sys/quota.h>
<sys/reboot.h>
<sys/resource.h>
<sys/sem.h>
<sys/sendfile.h>
<sys/socket.h>
<sys/stat.h>
<sys/statfs.h>
<sys/swap.h>
<sys/sysctl.h>
<sys/sysinfo.h>
<sys/syslog.h>
<sys/sysmacros.h>
<sys/time.h>
<sys/timex.h>
<sys/uio.h>
<sys/ustat.h>
<sys/vlimit.h>
<sys/vm86.h>
<sys/vtimes.h>
<sys/wait.h>
<sys/xattr.h>
<termios.h>
<time.h>
<ttyent.h>
<unistd.h>
acctbrkchrootdaemondup3endusershelleuidaccessexecvpeget_current_dir_namegetdomainnamegetdtablesizegetpagesizegetpassgetresgidgetresuidgetusershellgroup_memberpipe2profilrevokesbrksetloginsetdomainnamesethostidsethostnamesetresgidsetresuidsetusershellsyncfssyscallttyslotvhangup<utmp.h>
<utmpx.h>
<wchar.h>
fgetwc_unlockedfgetws_unlockedfputwc_unlockedfputws_unlockedgetwc_unlockedgetwchar_unlockedputwc_unlockedputwchar_unlockedwcschrnulwcsftime_lwcstod_lwcstof_lwcstol_lwcstold_lwcstoll_lwcstoqwcstoul_lwcstoull_lwcstouqwmempcpy.)| or \|)[ … ] and [^ … ])
( … ) or \( … \))\b)\B)\<)\>)\w)\W)Next: Philosophy, Previous: GNU Gnulib, Up: GNU Gnulib [Contents][Index]
Gnulib is a source code library that provides basic functionality to programs and libraries. Many software packages make use of Gnulib to avoid reinventing the portability wheel.
Resources:
Next: Git Checkout, Up: Brief Overview [Contents][Index]
While portability across operating systems is not one of GNU’s primary goals, it has helped introduce many people to the GNU system, and is worthwhile when it can be achieved at a low cost. This collection helps lower that cost.
Gnulib is intended to be the canonical source for most of the important “portability” and/or common files for GNU projects. These are files intended to be shared at the source level; Gnulib is not a typical library meant to be installed and linked against. Thus, unlike most projects, Gnulib does not normally generate a source tarball distribution; instead, developers grab modules directly from the source repository.
The easiest, and recommended, way to do this is to use the
gnulib-tool script. Since there is no installation
procedure for Gnulib, gnulib-tool needs to be run directly
in the directory that contains the Gnulib source code. You can do
this either by specifying the absolute filename of
gnulib-tool, or by using a symbolic link from a place inside
your PATH to the gnulib-tool file of your preferred
Gnulib checkout. For example:
$ ln -s $HOME/gnu/src/gnulib.git/gnulib-tool $HOME/bin/gnulib-tool
Next: Keeping Up-to-date, Previous: Gnulib Basics, Up: Brief Overview [Contents][Index]
Gnulib is available for anonymous checkout. In any Bourne-shell the following should work:
$ git clone git://git.sv.gnu.org/gnulib.git
For a read-write checkout you need to have a login on ‘savannah.gnu.org’ and be a member of the Gnulib project at https://savannah.gnu.org/projects/gnulib. Then, instead of the URL git://git.sv.gnu.org/gnulib, use the URL ‘ssh://user@git.sv.gnu.org/srv/git/gnulib’ where user is your login name on savannah.gnu.org.
git resources:
When you use git annotate or git blame with Gnulib, it’s
recommended that you use the -w option, in order to ignore
massive whitespace changes that happened in 2009.
Next: Contributing to Gnulib, Previous: Git Checkout, Up: Brief Overview [Contents][Index]
The best way to work with Gnulib is to check it out of git.
To synchronize, you can use git pull.
Subscribing to the bug-gnulib@gnu.org mailing list will help you to plan when to update your local copy of Gnulib (which you use to maintain your software) from git. You can review the archives, subscribe, etc., via https://lists.gnu.org/mailman/listinfo/bug-gnulib.
Sometimes, using an updated version of Gnulib will require you to use newer versions of GNU Automake or Autoconf. You may find it helpful to join the autotools-announce mailing list to be advised of such changes.
Next: Portability guidelines, Previous: Keeping Up-to-date, Up: Brief Overview [Contents][Index]
All software here is copyrighted by the Free Software Foundation—you need to have filled out an assignment form for a project that uses the module for that contribution to be accepted here.
If you have a piece of code that you would like to contribute, please email bug-gnulib@gnu.org.
Generally we are looking for files that fulfill at least one of the following requirements:
If your functions define completely new but rarely used functionality, you should probably consider packaging it as a separate library.
Next: Indent with spaces not TABs, Up: Contributing to Gnulib [Contents][Index]
Gnulib contains code both under GPL and LGPL. Because several packages that use Gnulib are GPL, the files state they are licensed under GPL. However, to support LGPL projects as well, you may use some of the files under LGPL. The “License:” information in the files under modules/ clarifies the real license that applies to the module source.
Keep in mind that if you submit patches to files in Gnulib, you should license them under a compatible license, which means that sometimes the contribution will have to be LGPL, if the original file is available under LGPL via a “License: LGPL” information in the projects’ modules/ file.
Next: How to add a new module, Previous: Gnulib licensing, Up: Contributing to Gnulib [Contents][Index]
We use space-only indentation in nearly all files. This includes all
*.h, *.c, *.y files, except for the regex
module. Makefile and ChangeLog files are excluded, since TAB
characters are part of their format.
In order to tell your editor to produce space-only indentation, you can use these instructions.
;; In Gnulib, indent with spaces everywhere (not TABs).
;; Exceptions: Makefile and ChangeLog modes.
(add-hook 'find-file-hook '(lambda ()
(if (and buffer-file-name
(string-match "/gnulib\\>" (buffer-file-name))
(not (string-equal mode-name "Change Log"))
(not (string-equal mode-name "Makefile")))
(setq indent-tabs-mode nil))))
" Don't use tabs for indentation. Spaces are nicer to work with. set expandtab
For Makefile and ChangeLog files, compensate for this by adding this to your $HOME/.vim/after/indent/make.vim file, and similarly for your $HOME/.vim/after/indent/changelog.vim file:
" Use tabs for indentation, regardless of the global setting. set noexpandtab
If you use the GNU indent program, pass it the option --no-tabs.
Previous: Indent with spaces not TABs, Up: Contributing to Gnulib [Contents][Index]
You can test that a module builds correctly with:
$ ./gnulib-tool --create-testdir --dir=/tmp/testdir module1 ... moduleN $ cd /tmp/testdir $ ./configure && make
Other things:
alloca and fnmatch modules for how to achieve this. If
for some reason you cannot do this, and you have a .c file that
leads to an empty .o file on some platforms (through some big
#if around all the code), then ensure that the compilation unit
is not empty after preprocessing. One way to do this is to
#include <stddef.h> or <stdio.h> before the big
#if.
Next: High Quality, Previous: Contributing to Gnulib, Up: Brief Overview [Contents][Index]
Gnulib code is intended to be portable to a wide variety of platforms, not just GNU platforms. Gnulib typically attempts to support a platform as long as it is still supported by its provider, even if the platform is not the latest version. See Target Platforms.
Many Gnulib modules exist so that applications need not worry about
undesirable variability in implementations. For example, an
application that uses the malloc module need not worry about
malloc (0) returning NULL on some Standard C
platforms; and glob users need not worry about glob
silently omitting symbolic links to nonexistent files on some
platforms that do not conform to POSIX.
Gnulib code is intended to port without problem to new hosts, e.g.,
hosts conforming to recent C and POSIX standards. Hence Gnulib code
should avoid using constructs that these newer standards no longer
require, without first testing for the presence of these constructs.
For example, because C11 made variable length arrays optional, Gnulib
code should avoid them unless it first uses the vararrays
module to check whether they are supported.
The following subsections discuss some exceptions and caveats to the general Gnulib portability guidelines.
Next: C99 features assumed by Gnulib, Up: Portability guidelines [Contents][Index]
Currently Gnulib assumes at least a freestanding C99 compiler, possibly operating with a C library that predates C99; with time this assumption will likely be strengthened to later versions of the C standard. Old platforms currently supported include AIX 6.1, HP-UX 11i v1 and Solaris 10, though these platforms are rarely tested. Gnulib itself is so old that it contains many fixes for obsolete platforms, fixes that may be removed in the future.
Because of the freestanding C99 assumption, Gnulib code can include
<float.h>, <limits.h>, <stdarg.h>,
<stdbool.h>, <stddef.h>, and <stdint.h>
unconditionally. Gnulib code can also assume the existence
of <ctype.h>, <errno.h>, <fcntl.h>,
<locale.h>, <signal.h>, <stdio.h>,
<stdlib.h>, <string.h>, and <time.h>. Similarly,
many modules include <sys/types.h> even though it’s not even in
C11; that’s OK since <sys/types.h> has been around nearly
forever.
Even if the include files exist, they may not conform to the C standard.
However, GCC has a fixincludes script that attempts to fix most
C89-conformance problems. Gnulib currently assumes include files
largely conform to C89 or better. People still using ancient hosts
should use fixincludes or fix their include files manually.
Even if the include files conform, the library itself may not.
For example, strtod and mktime have some bugs on some platforms.
You can work around some of these problems by requiring the relevant
modules, e.g., the Gnulib mktime module supplies a working and
conforming mktime.
Next: C99 features avoided by Gnulib, Previous: C language versions, Up: Portability guidelines [Contents][Index]
Although the C99 standard specifies many features, Gnulib code is conservative about using them, partly because Gnulib predates the widespread adoption of C99, and partly because many C99 features are not well-supported in practice. C99 features that are reasonably portable nowadays include:
for statement.
long long int.
<stdbool.h>, assuming the stdbool module is used.
See stdbool.h.
<stdint.h>, assuming the stdint module is used.
See stdint.h.
static inline functions.
__func__, assuming the func module is used. See func.
restrict qualifier, assuming
AC_REQUIRE([AC_C_RESTRICT]) is used.
flexmember module).
Next: Other portability assumptions made by Gnulib, Previous: C99 features assumed by Gnulib, Up: Portability guidelines [Contents][Index]
Gnulib avoids some features even though they are standardized by C99, as they have portability problems in practice. Here is a partial list of avoided C99 features. Many other C99 features are portable only if their corresponding modules are used; Gnulib code that uses such a feature should require the corresponding module.
__STDC_NO_VLA__ is defined.
See the vararrays module.
extern inline functions, without checking whether they are
supported. See Extern inline functions.
<iso646.h>, since GNU programs need not worry about deficient
source-code encodings.
Previous: C99 features avoided by Gnulib, Up: Portability guidelines [Contents][Index]
The GNU coding standards allow one departure from strict C: Gnulib
code can assume that standard internal types like size_t are no
wider than long. POSIX requires implementations to support at
least one programming environment where this is true, and such
environments are recommended for Gnulib-using applications. When it
is easy to port to non-POSIX platforms like MinGW where these types
are wider than long, new Gnulib code should do so, e.g., by
using ptrdiff_t instead of long. However, it is not
always that easy, and no effort has been made to check that all Gnulib
modules work on MinGW-like environments.
Gnulib code makes the following additional assumptions:
int and unsigned int are at least 32 bits wide. POSIX
and the GNU coding standards both require this.
Previously, Gnulib code sometimes assumed that signed integer arithmetic wraps around, but modern compiler optimizations sometimes do not guarantee this, and Gnulib code with this assumption is now considered to be questionable. See Integer Properties.
Although some Gnulib modules contain explicit support for the other signed integer representations allowed by the C standard (ones’ complement and signed magnitude), these modules are the exception rather than the rule. All practical Gnulib targets use two’s complement.
size_t values, then S + T cannot overflow.
(char *) &O <= (char *) P && (char *) P <
(char *) (&O + 1).
S + T cannot overflow.
Overflow in this case would mean that the rest of your program fits
into T bytes, which can’t happen in realistic flat-address-space
hosts.
memset (A, 0, sizeof A) initializes an array A of
pointers to NULL.
0 + (char *) NULL == (char *) NULL.
The above assumptions are not required by the C or POSIX standards but hold on all practical porting targets that we’re familiar with. If you have a porting target where these assumptions are not true, we’d appreciate hearing of any fixes. We need fixes that do not increase runtime overhead on standard hosts and that are relatively easy to maintain.
Previous: Portability guidelines, Up: Brief Overview [Contents][Index]
We develop and maintain a testsuite for Gnulib. The goal is to have a 100% firm interface so that maintainers can feel free to update to the code in git at any time and know that their application will not break. This means that before any change can be committed to the repository, a test suite program must be produced that exposes the bug for regression testing. All experimental work should be done on branches to help promote this.
Next: Invoking gnulib-tool, Previous: Brief Overview, Up: GNU Gnulib [Contents][Index]
Gnulib’s design and development philosophy is organized around steady, collaborative, and open development of reusable modules that are suitable for a reasonably wide variety of platforms.
Next: Library vs. Reusable Code, Up: Philosophy [Contents][Index]
Gnulib is useful to enhance various aspects of a package:
asprintf, canonicalize_file_name are not affected
by buffer sizing problems that affect sprintf, realpath.
openat does not have the race conditions that open has. Etc.
xalloc,
xprintf, xstrtod, xgetcwd.
Next: Portability and Application Code, Previous: Benefits of using Gnulib, Up: Philosophy [Contents][Index]
Classical libraries are installed as binary object code. Gnulib is
different: It is used as a source code library. Each package that uses
Gnulib thus ships with part of the Gnulib source code. The used portion
of Gnulib is tailored to the package: A build tool, called
gnulib-tool, is provided that copies a tailored subset of Gnulib
into the package.
Next: Target Platforms, Previous: Library vs. Reusable Code, Up: Philosophy [Contents][Index]
One of the goals of Gnulib is to make portable programming easy, on the basis of the standards relevant for GNU (and Unix). The objective behind that is to avoid a fragmentation of the user community into disjoint user communities according to the operating system, and instead allow synergies between users on different operating systems.
Another goal of Gnulib is to provide application code that can be shared between several applications. Some people wonder: "What? glibc doesn’t have a function to copy a file?" Indeed, the scope of a system’s libc is to implement the relevant standards (ISO C, POSIX) and to provide access functions to the kernel’s system calls, and little more.
There is no clear borderline between both areas.
For example, Gnulib has a facility for generating the name of backup files. While this task is entirely at the application level—no standard specifies an API for it—the naïve code has some portability problems because on some platforms the length of file name components is limited to 30 characters or so. Gnulib handles that.
Similarly, Gnulib has a facility for executing a command in a
subprocess. It is at the same time a portability enhancement (it
works on GNU, Unix, and Windows, compared to the classical
fork/exec idiom which is not portable to Windows), as well
as an application aid: it takes care of redirecting stdin and/or
stdout if desired, and emits an error message if the subprocess
failed.
Next: Modules, Previous: Portability and Application Code, Up: Philosophy [Contents][Index]
Gnulib supports a number of platforms that we call the “reasonable portability targets”. This class consists of widespread operating systems, for three years after their last availability, or—for proprietary operating systems—as long as the vendor provides commercial support for it. Already existing Gnulib code for older operating systems is usually left in place for longer than these three years. So it comes that programs that use Gnulib run pretty well also on these older operating systems.
Some operating systems are not very widespread, but are Free Software and are actively developed. Such platforms are also supported by Gnulib, if that OS’s developers community keeps in touch with the Gnulib developers, by providing bug reports, analyses, or patches. For such platforms, Gnulib supports only the versions of the last year or the last few months, depending on the maturity of said OS project, the number of its users, and how often these users upgrade.
Niche operating systems are generally unsupported by Gnulib, unless some of their developers or users contribute support to Gnulib.
The degree of support Gnulib guarantees for a platform depends on the amount of testing it gets from volunteers. Platforms on which Gnulib is frequently tested are the best supported. Then come platforms with occasional testing, then platforms which are rarely tested. Usually, we fix bugs when they are reported. Except that some rarely tested platforms are also low priority; bug fixes for these platforms can take longer.
As of 2016, the list of supported platforms is the following:
mgetgroups, getugroups, idcache,
userspec, openpty, login_tty, forkpty,
pt_chown, grantpt, pty, savewd,
mkancesdirs, mkdir-p, euidaccess, faccessat.
The versions of Windows that are supported are Windows XP and newer.
Only the latest version of mingw is tested; older versions are not supported.
suacomp library
(https://sourceforge.net/projects/suacomp/) in version 0.6.8 or newer.
Gnulib supports these operating systems only in an unvirtualized environment.
When you run an OS inside a virtual machine, you have to be aware that the
virtual machine can bring in bugs of its own. For example, floating-point
operations on Solaris can behave slightly differently in QEMU than on real
hardware. And Haiku’s bash program misbehaves in VirtualBox 3,
whereas it behaves fine in VirtualBox 4.
Similarly, running native Windows binaries on GNU/Linux under WINE is rarely tested and low priority: WINE has a set of behaviours and bugs that is slightly different from native Windows.
The following platforms are not supported by Gnulib. The cost of supporting them would exceed the benefit because they are rarely used, or poorly documented, or have been supplanted by other platforms, or diverge too much from POSIX, or some combination of these and other factors. Please don’t bother sending us patches for them.
Next: Various Kinds of Modules, Previous: Target Platforms, Up: Philosophy [Contents][Index]
Gnulib is divided into modules. Every module implements a single facility. Modules can depend on other modules.
A module consists of a number of files and a module description. The
files are copied by gnulib-tool into the package that will use it,
usually verbatim, without changes. Source code files (.h, .c files)
reside in the lib/ subdirectory. Autoconf macro files reside in
the m4/ subdirectory. Build scripts reside in the
build-aux/ subdirectory.
The module description contains the list of files; gnulib-tool
copies these files. It contains the module’s
dependencies; gnulib-tool installs them as well. It also
contains the autoconf macro invocation (usually a single line or
nothing at all); gnulib-tool ensures this is invoked from the
package’s configure.ac file. And also a Makefile.am
snippet; gnulib-tool collects these into a Makefile.am
for the tailored Gnulib part. The module description and include file
specification are for documentation purposes; they are combined into
MODULES.html.
The module system serves two purposes:
getopt_long function—this is a common way to implement parsing
of command line options in a way that complies with the GNU standards—needs
the source code (lib/getopt.c and others), the autoconf macro
which detects whether the system’s libc already has this function (in
m4/getopt.m4), and a few Makefile.am lines that create the
substitute getopt.h if not. These three pieces belong together.
They cannot be used without each other. The module description and
gnulib-tool ensure that they are copied altogether into the
destination package.
In other words, the module is the elementary unit of code in Gnulib, comparable to a class in object-oriented languages like Java or C#.
The module system is the basis of gnulib-tool. When
gnulib-tool copies a part of Gnulib into a package, it first
compiles a module list, starting with the requested modules and adding all
the dependencies, and then collects the files, configure.ac
snippets and Makefile.am snippets.
Next: Collaborative Development, Previous: Modules, Up: Philosophy [Contents][Index]
There are modules of various kinds in Gnulib. For a complete list of the modules, see in MODULES.html.
When a function is not implemented by a system, the Gnulib module provides an implementation under the same name. Examples are the ‘snprintf’ and ‘readlink’ modules.
Similarly, when a function is not correctly implemented by a system, Gnulib provides a replacement. For functions, we use the pattern
#if !HAVE_WORKING_FOO # define foo rpl_foo #endif
and implement the foo function under the name rpl_foo. This
renaming is needed to avoid conflicts at compile time (in case the system
header files declare foo) and at link/run time (because the code
making use of foo could end up residing in a shared library, and
the executable program using this library could be defining foo
itself).
For header files, such as stdbool.h or stdint.h, we provide
the substitute only if the system doesn’t provide a correct one. The
template of this replacement is distributed in a slightly different name,
with ‘.in’ inserted before the ‘.h’ extension, so that on
systems which do provide a correct
header file the system’s one is used.
These are sometimes POSIX functions with GNU extensions also found in glibc—examples: ‘getopt’, ‘fnmatch’—and often new APIs—for example, for all functions that allocate memory in one way or the other, we have variants which also include the error checking against the out-of-memory condition.
Examples are a module for copying a file—the portability problems
relate to the copying of the file’s modification time, access rights,
and extended attributes—or a module for extracting the tail
component of a file name—here the portability to native Windows
requires a different API than the classical POSIX basename function.
Examples are an error reporting function, a module that allows output of numbers with K/M/G suffixes, or cryptographic facilities.
Examples are data structures like ‘list’, or abstract output stream
classes that work around the fact that an application cannot implement an
stdio FILE with its logic. Here, while staying in C, we use
implementation techniques like tables of function pointers, known from the
C++ language or from the Linux kernel.
Examples are the ‘iconv’ module, which interfaces to the
iconv facility, regardless whether it is contained in libc or in
an external libiconv. Or the ‘readline’ module, which
interfaces to the GNU readline library.
An example is the ‘maintainer-makefile’ module, which provides extra Makefile tags for maintaining a package.
Next: Copyright, Previous: Various Kinds of Modules, Up: Philosophy [Contents][Index]
Gnulib is maintained collaboratively. The mailing list is
<bug-gnulib at gnu dot org>. Be warned that some people on the
list may be very active at some times and unresponsive at other times.
Every module has one or more maintainers. While issues are discussed collaboratively on the list, the maintainer of a module nevertheless has a veto right regarding changes in his module.
All patches should be posted the list, regardless whether they are proposed patches or whether they are committed immediately by the maintainer of the particular module. The purpose is not only to inform the other users of the module, but mainly to allow peer review. It is not uncommon that several people contribute comments or spot bugs after a patch was proposed.
Conversely, if you are using Gnulib, and a patch is posted that affects one of the modules that your package uses, you have an interest in proofreading the patch.
Next: Steady Development, Previous: Collaborative Development, Up: Philosophy [Contents][Index]
Most modules are under the GPL. Some, mostly modules which can reasonably be used in libraries, are under LGPL. The source files always say "GPL", but the real license specification is in the module description file. If the module description file says "GPL", it means "GPLv3+" (GPLv3 or newer, at the licensee’s choice); if it says "LGPL", it means "LGPLv3+" (LGPLv3 or newer, at the licensee’s choice).
More precisely, the license specification in the module description file applies to the files in lib/ and build-aux/. Different licenses apply to files in special directories:
Module description files are under this copyright:
Copyright © 20XX–20YY Free Software Foundation, Inc.
Copying and distribution of this file, with or without modification, in any medium, are permitted without royalty provided the copyright notice and this notice are preserved.
Autoconf macro files are under this copyright:
Copyright © 20XX–20YY Free Software Foundation, Inc.
This file is free software; the Free Software Foundation gives unlimited permission to copy and/or distribute it, with or without modifications, as long as this notice is preserved.
If a license statement is not present in a test module, the test files are under GPL. Even if the corresponding source module is under LGPL, this is not a problem, since compiled tests are not installed by “make install”.
Documentation files are under this copyright:
Copyright © 2004–20YY Free Software Foundation, Inc.
Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled “GNU Free Documentation License”.
If you want to use some Gnulib modules under LGPL, you can do so by
passing the option ‘--lgpl’ to gnulib-tool. This will
replace the GPL header with an LGPL header while copying the source
files to your package. Similarly, if you want some Gnulib modules
under LGPLv2+ (Lesser GPL version 2.1 or newer), you can do so by
passing the option ‘--lgpl=2’ to gnulib-tool.
Keep in mind that when you submit patches to files in Gnulib, you should license them under a compatible license. This means that sometimes the contribution will have to be LGPL, if the original file is available under LGPL. You can find out about it by looking for a "License: LGPL" information in the corresponding module description.
Next: Openness, Previous: Copyright, Up: Philosophy [Contents][Index]
Gnulib modules are continually adapted, to match new practices, to be consistent with newly added modules, or simply as a response to build failure reports. Gnulib is available in two qualities:
If you are willing to report an occasional regression, we recommend to use the newest version always, except in periods of major changes. Most Gnulib users do this. If you prefer stable releases, please use the newest stable release.
Previous: Steady Development, Up: Philosophy [Contents][Index]
Gnulib is open in the sense that we gladly accept contributions if they are generally useful, well engineered, and if the contributors have signed the obligatory papers with the FSF.
The module system is open in the sense that a package using Gnulib can
gnulib-tool.
This is achieved by the ‘--local-dir’ option of gnulib-tool
(see Extending Gnulib).
Next: Writing modules, Previous: Philosophy, Up: GNU Gnulib [Contents][Index]
The gnulib-tool command is the recommended way to import
Gnulib modules. It is possible to borrow Gnulib modules in a package
without using gnulib-tool, relying only on the
meta-information stored in the modules/* files, but with a
growing number of modules this becomes tedious. gnulib-tool
simplifies the management of source files, Makefile.ams and
configure.ac in packages incorporating Gnulib modules.
gnulib-tool is not installed in a standard directory that is
contained in the PATH variable. It needs to be run directly in
the directory that contains the Gnulib source code. You can do this
either by specifying the absolute filename of gnulib-tool, or
you can also use a symbolic link from a place inside your PATH
to the gnulib-tool file of your preferred and most up-to-date
Gnulib checkout, like this:
$ ln -s $HOME/gnu/src/gnulib.git/gnulib-tool $HOME/bin/gnulib-tool
Run ‘gnulib-tool --help’ for information. To get familiar with
gnulib-tool without affecting your sources, you can also try
some commands with the option ‘--dry-run’; then
gnulib-tool will only report which actions it would perform in
a real run without changing anything.
gettextize and autopoint usersNext: Initial import, Up: Invoking gnulib-tool [Contents][Index]
There are three ways of finding the names of Gnulib modules that you can use in your package:
Next: Modified imports, Previous: Finding modules, Up: Invoking gnulib-tool [Contents][Index]
Gnulib assumes that your project uses Autoconf. When using Gnulib, you will need to have Autoconf among your build tools.
Gnulib also assumes that your project’s configure.ac contains the line
AC_CONFIG_HEADERS([config.h])
The config.h file gets generated with platform dependent C macro definitions, and the source files include it (see Changing your sources for use with Gnulib).
Unless you use gnulib-tool’s --gnu-make option,
Gnulib also assumes that your project uses Automake at least in a
subdirectory of your project. While the use of Automake in your
project’s top level directory is an easy way to fulfil the Makefile
conventions of the GNU coding standards, Gnulib does not require it.
Invoking ‘gnulib-tool --import’ will copy source files, create a Makefile.am to build them, generate a file gnulib-comp.m4 with Autoconf M4 macro declarations used by configure.ac, and generate a file gnulib-cache.m4 containing the cached specification of how Gnulib is used.
Our example will be a library that uses Autoconf, Automake and
Libtool. It calls strdup, and you wish to use gnulib to make
the package portable to C99 and C11 (which don’t have strdup).
~/src/libfoo$ gnulib-tool --import strdup Module list with included dependencies: absolute-header extensions strdup string File list: lib/dummy.c lib/strdup.c lib/string.in.h m4/absolute-header.m4 m4/extensions.m4 m4/gnulib-common.m4 m4/strdup.m4 m4/string_h.m4 Creating directory ./lib Creating directory ./m4 Copying file lib/dummy.c Copying file lib/strdup.c Copying file lib/string.in.h Copying file m4/absolute-header.m4 Copying file m4/extensions.m4 Copying file m4/gnulib-common.m4 Copying file m4/gnulib-tool.m4 Copying file m4/strdup.m4 Copying file m4/string_h.m4 Creating lib/Makefile.am Creating m4/gnulib-cache.m4 Creating m4/gnulib-comp.m4 Finished. You may need to add #include directives for the following .h files. #include <string.h> Don't forget to - add "lib/Makefile" to AC_CONFIG_FILES in ./configure.ac, - mention "lib" in SUBDIRS in Makefile.am, - mention "-I m4" in ACLOCAL_AMFLAGS in Makefile.am, - invoke gl_EARLY in ./configure.ac, right after AC_PROG_CC, - invoke gl_INIT in ./configure.ac. ~/src/libfoo$
By default, the source code is copied into lib/ and the M4
macros in m4/. You can override these paths by using
--source-base=DIRECTORY and --m4-base=DIRECTORY. Some
modules also provide other files necessary for building. These files
are copied into the directory specified by ‘AC_CONFIG_AUX_DIR’ in
configure.ac or by the --aux-dir=DIRECTORY option. If
neither is specified, the current directory is assumed.
gnulib-tool can make symbolic links instead of copying the
source files. The option to specify for this is ‘--symlink’, or
‘-s’ for short. This can be useful to save a few kilobytes of disk
space. But it is likely to introduce bugs when gnulib is updated;
it is more reliable to use ‘gnulib-tool --update’ (see below)
to update to newer versions of gnulib. Furthermore it requires
extra effort to create self-contained tarballs, and it may disturb some
mechanism the maintainer applies to the sources. For these reasons,
this option is generally discouraged.
gnulib-tool will overwrite any pre-existing files, in
particular Makefile.am. It is also possible to separate the
generated Makefile.am content (for building the gnulib library)
into a separate file, say gnulib.mk, that can be included by your
handwritten Makefile.am, but this is a more advanced use of
gnulib-tool.
Consequently, it is a good idea to choose directories that are not
already used by your projects, to separate gnulib imported files from
your own files. This approach is also useful if you want to avoid
conflicts between other tools (e.g., gettextize that also copy
M4 files into your package. Simon Josefsson successfully uses a source
base of gl/, and a M4 base of gl/m4/, in several
packages.
After the ‘--import’ option on the command line comes the list of Gnulib modules that you want to incorporate in your package. The names of the modules coincide with the filenames in Gnulib’s modules/ directory.
Some Gnulib modules depend on other Gnulib modules. gnulib-tool
will automatically add the needed modules as well; you need not list
them explicitly. gnulib-tool will also memorize which dependent
modules it has added, so that when someday a dependency is dropped, the
implicitly added module is dropped as well (unless you have explicitly
requested that module).
If you want to cut a dependency, i.e., not add a module although one of your requested modules depends on it, you may use the option ‘--avoid=module’ to do so. Multiple uses of this option are possible. Of course, you will then need to implement the same interface as the removed module.
A few manual steps are required to finish the initial import.
gnulib-tool printed a summary of these steps.
First, you must ensure Autoconf can find the macro definitions in
gnulib-comp.m4. Use the ACLOCAL_AMFLAGS specifier in
your top-level Makefile.am file, as in:
ACLOCAL_AMFLAGS = -I m4
You are now ready to call the M4 macros in gnulib-comp.m4 from
configure.ac. The macro gl_EARLY must be called as soon
as possible after verifying that the C compiler is working.
Typically, this is immediately after AC_PROG_CC, as in:
... AC_PROG_CC gl_EARLY ...
If you are using AC_PROG_CC_STDC, the macro gl_EARLY must
be called after it, like this:
... AC_PROG_CC AC_PROG_CC_STDC gl_EARLY ...
The core part of the gnulib checks are done by the macro
gl_INIT. Place it further down in the file, typically where
you normally check for header files or functions. It must come after
other checks which may affect the compiler invocation, such as
AC_MINIX. For example:
... # For gnulib. gl_INIT ...
gl_INIT will in turn call the macros related with the
gnulib functions, be it specific gnulib macros, like gl_FUNC_ALLOCA
or Autoconf or Automake macros like AC_FUNC_ALLOCA or
AM_FUNC_GETLINE. So there is no need to call those macros yourself
when you use the corresponding gnulib modules.
You must also make sure that the gnulib library is built. Add the
Makefile in the gnulib source base directory to
AC_CONFIG_FILES, as in:
AC_CONFIG_FILES(... lib/Makefile ...)
You must also make sure that make will recurse into the gnulib
directory. To achieve this, add the gnulib source base directory to a
SUBDIRS Makefile.am statement, as in:
SUBDIRS = lib
or if you, more likely, already have a few entries in SUBDIRS,
you can add something like:
SUBDIRS += lib
Finally, you have to add compiler and linker flags in the appropriate source directories, so that you can make use of the gnulib library. Since some modules (‘getopt’, for example) may copy files into the build directory, top_builddir/lib is needed as well as top_srcdir/lib. For example:
... AM_CPPFLAGS = -I$(top_builddir)/lib -I$(top_srcdir)/lib ... LDADD = lib/libgnu.a ...
Don’t forget to #include the various header files. In this
example, you would need to make sure that ‘#include <string.h>’
is evaluated when compiling all source code files, that want to make
use of strdup.
In the usual case where Autoconf is creating a config.h file, you should include config.h first, before any other include file. That way, for example, if config.h defines ‘restrict’ to be the empty string on a non-C99 host, or a macro like ‘_FILE_OFFSET_BITS’ that affects the layout of data structures, the definition is consistent for all include files. Also, on some platforms macros like ‘_FILE_OFFSET_BITS’ and ‘_GNU_SOURCE’ may be ineffective, or may have only a limited effect, if defined after the first system header file is included.
Finally, note that you cannot use AC_LIBOBJ or
AC_REPLACE_FUNCS in your configure.ac and expect the
resulting object files to be automatically added to lib/libgnu.a.
This is because your AC_LIBOBJ and AC_REPLACE_FUNCS invocations
from configure.ac augment a variable @LIBOBJS@ (and/or
@LTLIBOBJS@ if using Libtool), whereas lib/libgnu.a
is built from the contents of a different variable, usually
@gl_LIBOBJS@ (or @gl_LTLIBOBJS@ if using Libtool).
Next: Simple update, Previous: Initial import, Up: Invoking gnulib-tool [Contents][Index]
You can at any moment decide to use Gnulib differently than the last time.
There are two ways to change how Gnulib is used. Which one you’ll use,
depends on where you keep track of options and module names that you pass
to gnulib-tool.
gnulib-tool
again, with modified options and more or fewer module names.
gnulib-tool remembers which modules were used last time. If you
want to rely on gnulib-tool’s own memory of the last used
options and module names, you can use the commands
gnulib-tool --add-import and
gnulib-tool --remove-import.
So, if you only want to use more Gnulib modules, simply invoke
gnulib-tool --add-import new-modules. The list of
modules that you pass after ‘--add-import’ is added to the
previous list of modules.
Similarly, if you want to use fewer Gnulib modules, simply invoke
gnulib-tool --remove-import unneeded-modules. The list
of modules that you pass after ‘--remove-import’ is removed
from the previous list of modules. Note that if a module is then still
needed as dependency of other modules, it will be used nevertheless.
If you want to really not use a module any more, regardless of
whether other modules may need it, you need to use the ‘--avoid’
option.
For other changes, such as different choices of ‘--lib’, ‘--source-base’ or ‘--aux-dir’, the normal way is to modify manually the file gnulib-cache.m4 in the M4 macros directory, then launch ‘gnulib-tool --add-import’.
The only change for which this doesn’t work is a change of the
‘--m4-base’ directory. Because, when you pass a different value of
‘--m4-base’, gnulib-tool will not find the previous
gnulib-cache.m4 file any more. A possible solution is to
manually copy the gnulib-cache.m4 into the new M4 macro directory.
In the gnulib-cache.m4 file, the macros have the following meaning:
gl_MODULESThe argument is a space separated list of the requested modules, not including dependencies.
gl_AVOIDThe argument is a space separated list of modules that should not be used, even if they occur as dependencies. Corresponds to the ‘--avoid’ command line argument.
gl_SOURCE_BASEThe argument is the relative file name of the directory containing the gnulib source files (mostly *.c and *.h files). Corresponds to the ‘--source-base’ command line argument.
gl_M4_BASEThe argument is the relative file name of the directory containing the gnulib M4 macros (*.m4 files). Corresponds to the ‘--m4-base’ command line argument.
gl_TESTS_BASEThe argument is the relative file name of the directory containing the gnulib unit test files. Corresponds to the ‘--tests-base’ command line argument.
gl_LIBThe argument is the name of the library to be created. Corresponds to the ‘--lib’ command line argument.
gl_LGPLThe presence of this macro without arguments corresponds to the ‘--lgpl’ command line argument. The presence of this macro with an argument (whose value must be 2 or 3) corresponds to the ‘--lgpl=arg’ command line argument.
gl_LIBTOOLThe presence of this macro corresponds to the ‘--libtool’ command line argument and to the absence of the ‘--no-libtool’ command line argument. It takes no arguments.
gl_MACRO_PREFIXThe argument is the prefix to use for macros in the gnulib-comp.m4 file. Corresponds to the ‘--macro-prefix’ command line argument.
Next: Changing your sources for use with Gnulib, Previous: Modified imports, Up: Invoking gnulib-tool [Contents][Index]
When you want to update to a more recent version of Gnulib, without changing the list of modules or other parameters, a simple call does it:
$ gnulib-tool --add-import
This will create, update or remove files, as needed.
Note: From time to time, changes are made in Gnulib that are not backward compatible. When updating to a more recent Gnulib, you should consult Gnulib’s NEWS file to check whether the incompatible changes affect your project.
Next: Modifying the build rules of a Gnulib import directory, Previous: Simple update, Up: Invoking gnulib-tool [Contents][Index]
Gnulib contains some header file overrides. This means that when building on systems with deficient header files in /usr/include/, it may create files named string.h, stdlib.h, stdint.h or similar in the build directory. In the other source directories of your package you will usually pass ‘-I’ options to the compiler, so that these Gnulib substitutes are visible and take precedence over the files in /usr/include/.
These Gnulib substitute header files rely on <config.h> being already included. Furthermore <config.h> must be the first include in every compilation unit. This means that to all your source files and likely also to all your tests source files you need to add an ‘#include <config.h>’ at the top. Which source files are affected? Exactly those whose compilation includes a ‘-I’ option that refers to the Gnulib library directory.
This is annoying, but inevitable: On many systems, <config.h> is
used to set system dependent flags (such as _GNU_SOURCE on GNU systems),
and these flags have no effect after any system header file has been included.
Next: Using Gnulib for both a library and a program, Previous: Changing your sources for use with Gnulib, Up: Invoking gnulib-tool [Contents][Index]
In some cases, you may want to set additional compiler options for
use within the Gnulib import directory. For example, the
‘relocatable’ module operates better if you define the C macros
ENABLE_COSTLY_RELOCATABLE and INSTALLDIR during its
compilation.
There are two ways to do so: Use of the gnulib-tool option
--makefile-name, and a kitchen-sink module.
With the gnulib-tool option --makefile-name, you are
telling gnulib-tool to generate an includable Makefile.am
portion, rather than a self-contained Makefile.am. For example,
when you use --makefile-name=Makefile.gnulib, gnulib-tool
will generate Makefile.gnulib, and you will provide a
hand-written Makefile.am that includes Makefile.gnulib
through a line such as
include Makefile.gnulib
Before this include, you need to initialize this set of Makefile.am
variables:
AUTOMAKE_OPTIONS
SUBDIRS
noinst_HEADERS
noinst_LIBRARIES
noinst_LTLIBRARIES
pkgdata_DATA (only with Automake ≥ 1.11.4)
EXTRA_DIST
BUILT_SOURCES
SUFFIXES
MOSTLYCLEANFILES
MOSTLYCLEANDIRS
CLEANFILES
DISTCLEANFILES
MAINTAINERCLEANFILES
AM_CPPFLAGS
AM_CFLAGS
AUTOMAKE_OPTIONS should be initialized as described in
Changing Automake’s Behavior in GNU Automake.
The other variables can be initialized to empty. However, you will most
likely want to initialize some of them with non-empty values, in order
to achieve the desired customization.
The other approach, the kitchen-sink module, is more advanced. See chapter Extending Gnulib.
Next: Caveat: gettextize and autopoint users, Previous: Modifying the build rules of a Gnulib import directory, Up: Invoking gnulib-tool [Contents][Index]
Your project might build both a library and some accompanying programs
in the same source tree. In that case you might want to use different
modules for the library than for the programs. Typically the programs
might want to make use of getopt-posix or version-etc,
while the library wants to stay clear of these modules for technical
or licensing reasons.
Let’s assume that your project contains a lib directory where the source of the library resides and a src directory for the sources of the programs as follows.
.
|-- configure.ac
|-- lib
| |-- foo.c
| `-- Makefile.am
|-- Makefile.am
`-- src
|-- bar.c
`-- Makefile.am
You can now add two instances of Gnulib to your project in separate source trees:
~/src/libfoo$ gnulib-tool --import --lib=libgnu --source-base=gnulib \
--m4-base=gnulib/m4 --macro-prefix=gl strndup
~/src/libfoo$ gnulib-tool --import --lib=libgnutools \
--source-base=src/gnulib --m4-base=src/gnulib/m4 \
--macro-prefix=gl_tools getopt-gnu
The first one will import the module strndup in gnulib
and the second one will import getopt-gnu in src/gnulib
and you will end up with the following source tree (many files omitted
in the interest of brevity):
.
|-- configure.ac
|-- gnulib
| |-- m4
| |-- strndup.c
|-- lib
| |-- foo.c
| `-- Makefile.am
|-- Makefile.am
`-- src
|-- bar.c
|-- gnulib
| |-- getopt.c
| |-- getopt.in.h
| |-- m4
`-- Makefile.am
Integration with your code is basically the same as outlined in
Initial import with the one exception that you have to add both
the macro gl_EARLY and the macro gl_tools_EARLY to your
configure.ac (and of course also both macros gl_INIT and
gl_tools_INIT). Obviously the name of the second macro is
dependent on the value of the --macro-prefix option in your
gnulib-tool invocation.
... AC_PROG_CC gl_EARLY gl_tools_EARLY ... # For gnulib. gl_INIT gl_tools_INIT ...
Also as outlined in Initial import you will have to add compiler and linker flags. For the library you might have to add something along the line of the following to your Makefile.am:
... AM_CPPFLAGS = -I$(top_srcdir)/gnulib -I$(top_builddir)/gnulib ... libfoo_la_LIBADD = $(top_builddir)/gnulib/libgnu.la ...
Correspondingly for the programs you will have to add something like this:
... AM_CPPFLAGS = -I$(top_srcdir)/src/gnulib -I$(top_builddir)/src/gnulib ... LIBADD = $(top_builddir)/src/gnulib/libgnutools.la ...
The name of the library that you have pass in the linker option
depends on the --lib option in gnulib-tool
invocation.
Next: Handling Gnulib’s own message translations, Previous: Using Gnulib for both a library and a program, Up: Invoking gnulib-tool [Contents][Index]
gettextize and autopoint usersThe programs gettextize and autopoint, part of
GNU gettext, import or update the internationalization infrastructure.
Some of this infrastructure, namely ca. 20 Autoconf macro files and the
config.rpath file, is also contained in Gnulib and may be imported
by gnulib-tool. The use of gettextize or autopoint
will therefore overwrite some of the files that gnulib-tool has
imported, and vice versa.
Avoiding to use gettextize (manually, as package maintainer) or
autopoint (as part of a script like autoreconf or
autogen.sh) is not the solution: These programs also import the
infrastructure in the po/ and optionally in the intl/ directory.
The copies of the conflicting files in Gnulib are more up-to-date than
the copies brought in by gettextize and autopoint. When a
new gettext release is made, the copies of the files in Gnulib will
be updated immediately.
The choice of which version of gettext to require depends on the needs of your package. For a package that wants to comply to GNU Coding Standards, the steps are:
gettextize, always use the gettextize from the
matching GNU gettext release. For the most recent Gnulib checkout, this is
the newest release found on https://ftp.gnu.org/gnu/gettext/. For an
older Gnulib snapshot, it is the release that was the most recent release
at the time the Gnulib snapshot was taken.
gettextize, invoke gnulib-tool and import
the gettext module. Also, copy the latest version of gnulib’s
build-aux/po/Makefile.in.in to your po/ directory (this
is done for you if you use gnulib’s bootstrap script).
*** error: gettext infrastructure mismatch:
using a Makefile.in.in from gettext version ...
but the Autoconf macros are from gettext version ...,
it means that a new GNU gettext release was made, and its Autoconf macros
were integrated into Gnulib and now mismatch the po/ infrastructure.
In this case, fetch and install the new GNU gettext release and run
gettextize followed by gnulib-tool.
On the other hand, if your package is not as concerned with compliance to the latest standards, but instead favors development on stable environments, the steps are:
gettext that you intend to
support during development (at this time, gnulib recommends going no
older than version 0.17). Run autopoint (not
gettextize) to copy infrastructure into place (newer versions
of gettext will install the older infrastructure that you requested).
gnulib-tool, and import the gettext-h module.
Regardless of which approach you used to get the infrastructure in place, the following steps must then be used to preserve that infrastructure (gnulib’s bootstrap script follows these rules):
autopoint, invoke gnulib-tool
afterwards.
autoreconf after gnulib-tool, make sure to
not invoke autopoint a second time, by setting the AUTOPOINT
environment variable, like this:
$ env AUTOPOINT=true autoreconf --install
Next: Issues with Version Control Systems, Previous: Caveat: gettextize and autopoint users, Up: Invoking gnulib-tool [Contents][Index]
Gnulib provides some functions that emit translatable messages using GNU
gettext. The ‘gnulib’ domain at the
Translation Project collects
translations of these messages, which you should incorporate into your
own programs.
There are two basic ways to achieve this. The first, and older, method is to list all the source files you use from Gnulib in your own po/POTFILES.in file. This will cause all the relevant translatable strings to be included in your POT file. When you send this POT file to the Translation Project, translators will normally fill in the translations of the Gnulib strings from their “translation memory”, and send you back updated PO files.
However, this process is error-prone: you might forget to list some source files, or the translator might not be using a translation memory and provide a different translation than another translator, or the translation might not be kept in sync between Gnulib and your package. It is also slow and causes substantial extra work, because a human translator must be in the loop for each language and you will need to incorporate their work on request.
For these reasons, a new method was designed and is now recommended. If
you pass the --po-base=directory and --po-domain=domain
options to gnulib-tool, then gnulib-tool will create a
separate directory with its own POTFILES.in, and fetch current
translations directly from the Translation Project (using
rsync or wget, whichever is available).
The POT file in this directory will be called
domain-gnulib.pot, depending on the domain you gave to the
--po-domain option (typically the same as the package name).
This causes these translations to reside in a separate message domain,
so that they do not clash either with the translations for the main part
of your package nor with those of other packages on the system that use
possibly different versions of Gnulib.
When you use these options, the functions in Gnulib are built
in such a way that they will always use this domain regardless of the
default domain set by textdomain.
In order to use this method, you must—in each program that might use Gnulib code—add an extra line to the part of the program that initializes locale-dependent behavior. Where you would normally write something like:
setlocale (LC_ALL, ""); bindtextdomain (PACKAGE, LOCALEDIR); textdomain (PACKAGE);
you should add an additional bindtextdomain call to inform
gettext of where the MO files for the extra message domain may be found:
bindtextdomain (PACKAGE "-gnulib", LOCALEDIR);
(This example assumes that the domain that you specified
to gnulib-tool is the same as the value of the PACKAGE
preprocessor macro.)
Since you do not change the textdomain call, the default message
domain for your program remains the same and your own use of gettext
functions will not be affected.
Next: Bundling the unit tests of the Gnulib modules, Previous: Handling Gnulib’s own message translations, Up: Invoking gnulib-tool [Contents][Index]
If a project stores its source files in a version control system (VCS), such as CVS, Subversion, or Git, one needs to decide which files to commit.
In principle, all files created by gnulib-tool, except
gnulib-cache.m4, can be treated like generated source files,
like for example a parser.c file generated from
parser.y. Alternatively, they can be considered source files
and updated manually.
Here are the three different approaches in common use. Each has its place, and you should use whichever best suits your particular project and development methods.
gnulib-tool generated files should all be
committed. In this case, you should pass the option
‘--no-vc-files’ to gnulib-tool, which avoids alteration of
VCS-related files such as .gitignore.
Gnulib also contains files generated by make (and removed by
make clean), using information determined by
configure. For a Gnulib source file of the form
lib/foo.in.h, the corresponding lib/foo.h is such a
make-generated file. These should not be checked
into the VCS, but instead added to .gitignore or equivalent.
gnulib-tool. The command for restoring the omitted files
depends on it:
gnulib-cache.m4, such as
autogen.sh, bootstrap, bootstrap.conf, or similar,
the restoration command is the entire gnulib-tool ... --import ...
invocation with all options and module names.
gnulib-tool’s memory of the last used
options and module names, then the file gnulib-cache.m4 in the M4
macros directory must be added to the VCS, and the restoration command
is:
$ gnulib-tool --update
The ‘--update’ option operates much like the ‘--add-import’ option, but it does not offer the possibility to change the way Gnulib is used. Also it does not report in the ChangeLogs the files that it had to add because they were missing.
Gnulib includes the file build-aux/bootstrap to aid a developer in using this setup. Furthermore, in projects that use git for version control, it is possible to use a git submodule containing the precise commit of the gnulib repository, so that each developer running bootstrap will get the same version of all gnulib-provided files. The location of the submodule can be chosen to fit the package’s needs; here’s how to initially create the submodule in the directory .gnulib:
$ dir=.gnulib $ git submodule add -- git://git.sv.gnu.org/gnulib.git $dir $ git config alias.syncsub "submodule foreach git pull origin master"
Thereafter, bootstrap can run this command to update the submodule to the recorded checkout level:
git submodule update --init $dir
and a developer can use this sequence to update to a newer version of gnulib:
$ git syncsub $ git add $dir $ ./bootstrap
Makefile.in generated by Automake. This
increases the size and complexity of the repository, but can help
occasional contributors by not requiring them to have a full Gnulib
checkout to do a build, and all developers by ensuring that all
developers are working with the same version of Gnulib in the
repository. It also supports multiple Gnulib instances within a
project. It remains important not to commit the
make-generated files, as described above.
Next: Avoiding unnecessary checks and compilations, Previous: Issues with Version Control Systems, Up: Invoking gnulib-tool [Contents][Index]
You can bundle the unit tests of the Gnulib modules together with your
package, through the ‘--with-tests’ option. Together with
‘--with-tests’, you also specify the directory for these tests
through the ‘--tests-base’ option. Of course, you need to add this
directory to the SUBDIRS variable in the Makefile.am of
the parent directory.
The advantage of having the unit tests bundled is that when your program has a problem on a particular platform, running the unit tests may help determine quickly if the problem is on Gnulib’s side or on your package’s side. Also, it helps verifying Gnulib’s portability, of course.
The unit tests will be compiled and run when the user runs ‘make check’. When the user runs only ‘make’, the unit tests will not be compiled.
In the SUBDIRS variable, it is useful to put the Gnulib tests directory
after the directory containing the other tests, not before:
SUBDIRS = gnulib-lib src man tests gnulib-tests
This will ensure that on platforms where there are test failures in either directory, users will see and report the failures from the tests of your program.
Note: In packages which use more than one invocation of gnulib-tool
in the scope of the same configure.ac, you cannot use
‘--with-tests’. You will have to use a separate configure.ac
in this case.
Previous: Bundling the unit tests of the Gnulib modules, Up: Invoking gnulib-tool [Contents][Index]
In some cases, a module is needed by another module only on specific
platforms. But when a module is present, its Autoconf checks are always
executed, and its Makefile.am additions are always enabled. So
it can happen that some Autoconf checks are executed and some source files
are compiled, although no other module needs them on this particular
platform, just in case some other module would need them.
The option ‘--conditional-dependencies’ enables an optimization of
configure checks and Makefile.am snippets that avoids this. With
this option, whether a module is considered “present” is no longer decided
when gnulib-tool is invoked, but later, when configure is run.
This applies to modules that were added as dependencies while
gnulib-tool was run; modules that were passed on the command line
explicitly are always “present”.
For example, the timegm module needs, on platforms
where the system’s timegm function is missing or buggy, a replacement
that is based on a function mktime_internal. The module
mktime-internal that provides this function provides it on all
platforms. So, by default, the file mktime-internal.c will be
compiled on all platforms, even on glibc and BSD systems which have a
working timegm function. When the option
‘--conditional-dependencies’ is given, on the other hand, and if
mktime-internal was not explicitly required on the command line,
the file mktime-internal.c will only be compiled on the platforms
where the timegm needs them.
Conditional dependencies are specified in the module description by putting
the condition on the same line as the dependent module, enclosed in brackets.
The condition is a boolean shell expression that can assume that the
configure.ac snippet from the module description has already been
executed. In the example above, the dependency from timegm to
mktime-internal is written like this:
Depends-on: ... mktime-internal [test $HAVE_TIMEGM = 0 || test $REPLACE_TIMEGM = 1] ...
Note: The option ‘--conditional-dependencies’ cannot be used together
with the option ‘--with-tests’. It also cannot be used when a package
uses gnulib-tool for several subdirectories, with different values
of ‘--source-base’, in the scope of a single configure.ac file.
Next: Extending Gnulib, Previous: Invoking gnulib-tool, Up: GNU Gnulib [Contents][Index]
This chapter explains how to write modules of your own, either to extend Gnulib for your own package (see Extending Gnulib), or for inclusion in gnulib proper.
The guidelines in this chapter do not necessarily need to be followed for
using gnulib-tool. They merely represent a set of good practices.
Following them will result in a good structure of your modules and in
consistency with gnulib.
Next: Header files, Up: Writing modules [Contents][Index]
Every API (C functions or variables) provided should be declared in a header file (.h file) and implemented in one or more implementation files (.c files). The separation has the effect that users of your module need to read only the contents of the .h file and the module description in order to understand what the module is about and how to use it—not the entire implementation. Furthermore, users of your module don’t need to repeat the declarations of the functions in their code, and are likely to receive notification through compiler errors if you make incompatible changes to the API (like, adding a parameter or changing the return type of a function).
Next: Implementation files, Previous: Source code files, Up: Writing modules [Contents][Index]
The .h file should declare the C functions and variables that the module provides.
The .h file should be stand-alone. That is, it does not require other .h files to be included before. Rather, it includes all necessary .h files by itself.
It is a tradition to use CPP tricks to avoid parsing the same header file more than once, which might cause warnings. The trick is to wrap the content of the header file (say, foo.h) in a block, as in:
#ifndef FOO_H # define FOO_H ... body of header file goes here ... #endif /* FOO_H */
Whether to use FOO_H or _FOO_H is a matter of taste and
style. The C99 and C11 standards reserve all identifiers that begin with an
underscore and either an uppercase letter or another underscore, for
any use. Thus, in theory, an application might not safely assume that
_FOO_H has not already been defined by a library. On the other
hand, using FOO_H will likely lead the higher risk of
collisions with other symbols (e.g., KEY_H, XK_H, BPF_H,
which are CPP macro constants, or COFF_LONG_H, which is a CPP
macro function). Your preference may depend on whether you consider
the header file under discussion as part of the application (which has
its own namespace for CPP symbols) or a supporting library (that
shouldn’t interfere with the application’s CPP symbol namespace).
Adapting C header files for use in C++ applications can use another CPP trick, as in:
# ifdef __cplusplus
extern "C"
{
# endif
...
body of header file goes here
...
# ifdef __cplusplus
}
# endif
The idea here is that __cplusplus is defined only by C++
implementations, which will wrap the header file in an ‘extern "C"’
block. Again, whether to use this trick is a matter of taste and
style. While the above can be seen as harmless, it could be argued
that the header file is written in C, and any C++ application using it
should explicitly use the ‘extern "C"’ block itself. Your
preference might depend on whether you consider the API exported by
your header file as something available for C programs only, or for C
and C++ programs alike.
Note that putting a #include in an extern "C" { ... }
block yields a syntax error in C++ mode on some platforms (e.g., glibc
systems with g++ v3.3 to v4.2, AIX, OSF/1, IRIX). For this reason, it
is recommended to place the #include before the extern
"C" block.
Next: Specification, Previous: Header files, Up: Writing modules [Contents][Index]
The .c file or files implement the functions and variables declared in the .h file.
Every implementation file must start with ‘#include <config.h>’.
This is necessary for activating the preprocessor macros that are defined
on behalf of the Autoconf macros. Some of these preprocessor macros,
such as _GNU_SOURCE, would have no effect if defined after a system
header file has already been included.
Then comes the ‘#include "..."’ specifying the header file that is being implemented. Putting this right after ‘#include <config.h>’ has the effect that it verifies that the header file is self-contained.
Then come the system and application headers. It is customary to put all the system headers before all application headers, so as to minimize the risk that a preprocessor macro defined in an application header confuses the system headers on some platforms.
In summary:
Next: Module description, Previous: Implementation files, Up: Writing modules [Contents][Index]
The specification of a function should answer at least the following questions:
Where to put the specification describing exported functions? Three practices are used in gnulib:
In any case, the specification should appear in just one place, unless you can ensure that the multiple copies will always remain identical.
The advantage of putting it in the header file is that the user only has to read the include file normally never needs to peek into the implementation file(s).
The advantage of putting it in the implementation file is that when reviewing or changing the implementation, you have both elements side by side.
The advantage of texinfo formatted documentation is that it is easily published in HTML or Info format.
Currently (as of 2010), half of gnulib uses the first practice, nearly half of gnulib uses the second practice, and a small minority uses the texinfo practice.
Next: Autoconf macros, Previous: Specification, Up: Writing modules [Contents][Index]
For the module description, you can start from an existing module’s description, or from a blank one: module/TEMPLATE for a normal module, or module/TEMPLATE-TESTS for a unit test module. Some more fields are possible but rarely used. Use module/TEMPLATE-EXTENDED if you want to use one of them.
Module descriptions have the following fields. Absent fields are equivalent to fields with empty contents.
This field should contain a concise description of the module’s functionality. One sentence is enough. For example, if it defines a single function ‘frob’, the description can be ‘frob() function: frobnication.’ Gnulib’s documentation generator will automatically convert the first part to a hyperlink when it has this form.
This field is either empty/absent, or contains the word ‘obsolete’. In
the latter case, gnulib-tool will, unless the option
--with-obsolete is given, omit it when it used as a dependency. It is
good practice to also notify the user about an obsolete module. This is done
by putting into the ‘Notice’ section (see below) text like
‘This module is obsolete.’
This field contains text that gnulib-tool will show to the user
when the module is used. This can be a status indicator like
‘This module is obsolete.’ or additional advice. Do not abuse this
field.
This field is either empty/absent, or contains the word ‘all’. It
describes to which Makefile.am the module is applied. By default,
a normal module is applied to source_base/Makefile.am
(normally lib/Makefile.am), whereas a module ending in -tests
is applied to tests_base/Makefile.am (normally
tests/Makefile.am). If this field is ‘all’, it is applied to
both Makefile.ams. This is useful for modules which provide
Makefile.am macros rather than compiled source code.
This field contains a newline separated list of the files that are part of
the module. gnulib-tool copies these files into the package that
uses the module.
This list is typically ordered by importance: First comes the header file, then the implementation files, then other files.
It is possible to have the same file mentioned in multiple modules. That is, if the maintainers of that module agree on the purpose and future of said file.
This field contains a newline separated list of the modules that are required
for the proper working of this module. gnulib-tool includes each
required module automatically, unless it is specified with option
--avoid or it is marked as obsolete and the option
--with-obsolete is not given.
A test modules foo-tests implicitly depends on the corresponding non-test
module foo. foo implicitly depends on foo-tests if the
latter exists and if the option --with-tests has been given.
Tests modules can depend on non-tests modules. Non-tests modules should not depend on tests modules. (Recall that tests modules are built in a separate directory.)
Each listed required module may be declared a conditional dependency. This
is indicated by placing the condition for the dependency on the same line,
enclosed in brackets, after the name of the required module. The condition
is a shell expression that is run after the module’s configure.ac
statements. For example:
strtoull [test $ac_cv_func_strtoumax = no]
Lines starting with # are recognized as comments and are ignored.
This field contains configure.ac stuff (Autoconf macro invocations and
shell statements) that are logically placed early in the configure.ac
file: right after the AC_PROG_CC invocation. This section is adequate
for statements that modify CPPFLAGS, as these can affect the results of
other Autoconf macros.
This field contains configure.ac stuff (Autoconf macro invocations and shell statements).
It is forbidden to add items to the CPPFLAGS variable here, other than
temporarily, as these could affect the results of other Autoconf macros.
We avoid adding items to the LIBS variable, other than temporarily.
Instead, the module can export an Autoconf-substituted variable that contains
link options. The user of the module can then decide to which executables
to apply which link options. Recall that a package can build executables of
different kinds and purposes; having all executables link against all
libraries is inappropriate.
If the statements in this section grow larger than a couple of lines, we
recommend moving them to a .m4 file of their own.
This field contains Makefile.am statements. Variables like
lib_SOURCES are transformed to match the name of the library
being built in that directory. For example, lib_SOURCES may become
libgnu_a_SOURCES (for a plain library) or libgnu_la_SOURCES
(for a libtool library). Therefore, the normal way of having an
implementation file lib/foo.c compiled unconditionally is to write
lib_SOURCES += foo.c
This field contains the preprocessor statements that users of the module need to add to their source code files. Typically it’s a single include statement. A shorthand is allowed: You don’t need to write the word “#include”, just the name of the include file in the way it will appear in an include statement. Example:
"foo.h"
This field contains the set of libraries that are needed when linking
libraries or executables that use this module. Often this will be
written as a reference to a Makefile variable. Please write them
one per line, so that gnulib-tool can remove duplicates
when presenting a summary to the user.
Example:
$(POW_LIBM) $(LTLIBICONV) when linking with libtool, $(LIBICONV) otherwise
This field specifies the license that governs the source code parts of this module. See Copyright for details.
This field specifies the persons who have a definitive say about proposed
changes to this module. You don’t need to mention email addresses here:
they can be inferred from the ChangeLog file.
Please put at least one person here. We don’t like unmaintained modules.
Next: Unit test modules, Previous: Module description, Up: Writing modules [Contents][Index]
For a module foo, an Autoconf macro file m4/foo.m4 is typically
created when the Autoconf macro invocations for the module are longer than
one or two lines.
The name of the main entry point into this Autoconf macro file is typically
gl_FOO. For modules outside Gnulib that are not likely to be moved
into Gnulib, please use a prefix specific to your package: gt_ for
GNU gettext, cu_ for GNU coreutils, etc.
For modules that define a function foo, the entry point is called
gl_FUNC_FOO instead of gl_FOO. For modules that provide a
header file with multiple functions, say foo.h, the entry point is
called gl_FOO_H or gl_HEADER_FOO_H. This convention is useful
because sometimes a header and a function name coincide (for example,
fcntl and fcntl.h).
For modules that provide a replacement, it is useful to split the Autoconf
macro into two macro definitions: one that detects whether the replacement
is needed and requests the replacement using AC_LIBOBJ (this is the
entry point, say gl_FUNC_FOO), and one that arranges for the macros
needed by the replacement code lib/foo.c (typically called
gl_PREREQ_FOO). The reason of this separation is
lib/foo.c, all you have to review
is the Depends-on section of the module description and the
gl_PREREQ_FOO macro in the Autoconf macro file.
Next: Incompatible changes, Previous: Autoconf macros, Up: Writing modules [Contents][Index]
A unit test that is a simple C program usually has a module description as simple as this:
Files: tests/test-foo.c tests/macros.h Depends-on: configure.ac: Makefile.am: TESTS += test-foo check_PROGRAMS += test-foo
The test program tests/test-foo.c often has the following structure:
ASSERT macro.
The body of the test, then, contains many ASSERT invocations. When
a test fails, the ASSERT macro prints the line number of the failing
statement, thus giving you, the developer, an idea of which part of the test
failed, even when you don’t have access to the machine where the test failed
and the reporting user cannot run a debugger.
Sometimes it is convenient to write part of the test as a shell script. (For example, in areas related to process control or interprocess communication, or when different locales should be tried.) In these cases, the typical module description is like this:
Files: tests/test-foo.sh tests/test-foo.c tests/macros.h Depends-on: configure.ac: Makefile.am: TESTS += test-foo.sh TESTS_ENVIRONMENT += FOO_BAR='@FOO_BAR@' check_PROGRAMS += test-foo
Here, the TESTS_ENVIRONMENT variable can be used to pass values
determined by configure or by the Makefile to the shell
script, as environment variables. The Autoconf values EXEEXT
and srcdir are already provided as environment variables,
through an initial value of TESTS_ENVIRONMENT that
gnulib-tool puts in place.
Regardless of the specific form of the unit test, the following guidelines should be respected:
ASSERT macro already does so.
fputs ("Skipping test: multithreading not enabled\n", stderr);
return 77;
Such a message helps detecting bugs in the autoconf macros: A simple message ‘SKIP: test-foo’ does not sufficiently catch the attention of the user.
Previous: Unit test modules, Up: Writing modules [Contents][Index]
Incompatible changes to Gnulib modules should be mentioned in Gnulib’s NEWS file. Incompatible changes here mean that existing source code may not compile or work any more.
We don’t mean changes in the binary interface (ABI), since
Next: Miscellaneous Notes, Previous: Writing modules, Up: GNU Gnulib [Contents][Index]
Gnulib modules are intended to be suitable for widespread use. Most problems with Gnulib can and should be fixed in a generic way, so that all of Gnulib’s users can benefit from the change. But occasionally a problem arises that is difficult or undesirable to fix generically, or a project that uses Gnulib may need to work around an issue before the Gnulib maintainers commit a final fix. Maintainers may also want to add their own pools of modules to projects as Gnulib “staging areas.”
The obvious way to make local changes to Gnulib modules is to use
gnulib-tool to check out pristine modules, then to modify
the results in-place. This works well enough for short-lived
experiments. It is harder to keep modified versions of Gnulib modules
for a long time, even though Git (or another distributed version
control systems) can help out a lot with this during the development
process.
Git, however, doesn’t address the distribution issue. When a package
“foobar” needs a modified version of, say, stdint.in.h, it
either has to put a comment into foobar/autogen.sh saying
“Attention! This doesn’t work with a pristine Gnulib, you need this
and that patch after checking out Gnulib,” or it has to use the
‘--avoid=stdint’ option and provide the modified stdint
module in a different directory.
The --local-dir option to gnulib-tool solves this
problem. It allows the package to override or augment Gnulib. This
means:
gnulib-tool option --makefile-name.)
In a release tarball, you can distribute the contents of this --local-dir directory that will be combinable with newer versions of Gnulib, barring incompatible changes to Gnulib.
If the --local-dir=directory option is specified, then
gnulib-tool looks in directory whenever it
reads a file from the Gnulib directory. Suppose gnulib-tool
is looking for file. Then:
gnulib-tool uses
it instead of the file included in Gnulib.
gnulib-tool uses the file from Gnulib after applying the diff
using the patch program.
gnulib-tool uses the file included in Gnulib.
Please make wise use of this option. It also allows you to easily hold back modifications you make to Gnulib macros in cases it may be better to share them.
Next: Building the ISO C and POSIX Substitutes, Previous: Extending Gnulib, Up: GNU Gnulib [Contents][Index]
Next: Obsolete modules, Up: Miscellaneous Notes [Contents][Index]
The gnulib API does not have a standard error code for the out of memory error condition. Instead of adding a non-standard error code, gnulib has chosen to adopt a different strategy. Out of memory handling happens in rare situations, but performing the out of memory error handling after almost all API function invocations pollute your source code and might make it harder to spot more serious problems. The strategy chosen improves code readability and robustness.
For most applications, aborting the application with an error message when the out of memory situation occurs is the best that can be wished for. This is how the library behaves by default (using the ‘xalloc-die’ module).
However, we realize that some applications may not want to abort
execution in any situation. Gnulib supports a hook to let the
application regain control and perform its own cleanups when an out of
memory situation has occurred. The application can define a function
(having a void prototype, i.e., no return value and no
parameters) and set the library variable
xalloc_die to that function. The variable should be
declared as follows.
extern void (*xalloc_die) (void);
Gnulib will invoke this function if an out of memory error occurs. Note that the function should not return. Of course, care must be taken to not allocate more memory, as that will likely also fail.
Next: Extra tests modules, Previous: Out of memory handling, Up: Miscellaneous Notes [Contents][Index]
Modules can be marked obsolete. This means that the problems they fix
don’t occur any more on the platforms that are reasonable porting targets
now. gnulib-tool warns when obsolete modules are mentioned on the
command line, and by default ignores dependencies from modules to obsolete
modules. When you pass the option --with-obsolete to
gnulib-tool, dependencies to obsolete modules will be included,
however, unless blocked through an --avoid option. This option
is useful if your package should be portable even to very old platforms.
In order to mark a module obsolete, you need to add this to the module description:
Status: obsolete Notice: This module is obsolete.
Next: Modules that modify the way other modules work, Previous: Obsolete modules, Up: Miscellaneous Notes [Contents][Index]
Test modules can be marked with some special status attributes. When a
test module has such an attribute, gnulib-tool --import will not
include it by default.
The supported status attributes are:
c++-testIndicates that the test is testing C++ interoperability. Such a test is useful in a C++ or mixed C/C++ package, but is useless in a C package.
longrunning-testIndicates that the test takes a long time to compile or execute (more than five minutes or so). Such a test is better avoided in a release that is made for the general public.
privileged-testIndicates that the test will request special privileges, for example, ask for the superuser password. Such a test may hang when run non-interactively and is therefore better avoided in a release that is made for the general public.
unportable-testIndicates that the test is known to fail on some systems, and that there is no workaround about it. Such a test is better avoided in a release that is made for the general public.
gnulib-tool --import --with-tests will not include tests marked with
these attributes by default. When gnulib-tool is invoked with one
of the options --with-c++-tests, --with-longrunning-tests,
--with-privileged-tests, --with-unportable-tests, it
will include tests despite the corresponding special status attribute.
When gnulib-tool receives the option --with-all-tests,
it will include all tests regardless of their status attributes.
gnulib-tool --create-testdir --with-tests and
gnulib-tool --create-megatestdir --with-tests by default include all
tests of modules specified on the command line, regardless of their status
attributes. Tests of modules occurring as dependencies are not included
by default if they have one of these status attributes. The options
--with-c++-tests, --with-longrunning-tests,
--with-privileged-tests, --with-unportable-tests are
recognized here as well. Additionally, gnulib-tool also
understands the options --without-c++-tests,
--without-longrunning-tests, --without-privileged-tests,
--without-unportable-tests.
In order to mark a module with a status attribute, you need to add it to the module description, like this:
Status: longrunning-test
If only a part of a test deserves a particular status attribute, you
can split the module into a primary and a secondary test module,
say foo-tests and foo-extra-tests. Then add a dependency
from foo-tests to foo-extra-tests, and mark the
foo-extra-tests with the particular status attribute.
Next: A C++ namespace for gnulib, Previous: Extra tests modules, Up: Miscellaneous Notes [Contents][Index]
The normal way to design modules is that each module has its own code, and the module dependencies provide the facilities on which this code can rely. But sometimes it is necessary to use more advanced techniques. For example:
n against zero when you call malloc (n).
Be aware that these advanced techniques likely cause breakage in the
situation of multiple gnulib-tool invocations in the scope of a
single configure file. This is because the question “is module
B present?” does not have a unique answer in such situations.
gnulib-tool has support for these techniques in the situation of
--create-testdir --single-configure, which basically has two
gnulib-tool invocations, one for a set of modules that end up in
gllib, and one for the set of modules that end up in
gltests. But you should be aware that this does not cover the
general situation.
Which technique to use, depends on the answer to the question: “If my
module occurs among the modules of gltests, should it have an
effect on the modules in gllib?”
If the answer is “no”, your module description should invoke the
Autoconf macro gl_MODULE_INDICATOR. This Autoconf macro takes
one argument: the name of your module. The effect of
gl_MODULE_INDICATOR([my-module]) is to define, in
config.h, a C macro GNULIB_MY_MODULE that indicates
whether your macro is considered to be present. This works even when
your macro is used in gltests: GNULIB_MY_MODULE
will then evaluate to 1 in gltests but to 0 in gllib.
If the answer is “yes”, you have two techniques available. The first
one is to invoke a similar Autoconf macro, named
gl_MODULE_INDICATOR_FOR_TESTS. It works similarly. However,
when your macro is used in gltests, GNULIB_MY_MODULE
will evaluate to 1 both in gltests and in gllib.
The second one is to define a shell variable in the configure
file that tells whether your module is present, through use of
m4_divert_text. The Autoconf macros of a dependency module will
initialize this shell variable, through
‘m4_divert_text([DEFAULTS], [my_shell_var=no])’. The
Autoconf macros of your module will override this value, through
‘m4_divert_text([INIT_PREPARE], [my_shell_var=yes])’. Then
you can use my_shell_var in the Autoconf macros of both
modules. You can find more details about this technique in the Gnulib
module getopt-gnu.
Reminder: These techniques are advanced. They have the potential to cause lots of headaches if you apply them incorrectly.
Next: Running self-tests under valgrind, Previous: Modules that modify the way other modules work, Up: Miscellaneous Notes [Contents][Index]
The function definitions provided by Gnulib (.c code) are meant
to be compiled by a C compiler. The header files (.h files),
on the other hand, can be used in either C or C++.
By default, when used in a C++ compilation unit, the .h files
declare the same symbols and overrides as in C mode, except that functions
defined by Gnulib or by the system are declared as ‘extern "C"’.
It is also possible to indicate to Gnulib to provide many of its symbols
in a dedicated C++ namespace. If you define the macro
GNULIB_NAMESPACE to an identifier, many functions will be defined
in the namespace specified by the identifier instead of the global
namespace. For example, after you have defined
#define GNULIB_NAMESPACE gnulib
at the beginning of a compilation unit, Gnulib’s <fcntl.h> header
file will make available the open function as gnulib::open.
The symbol open will still refer to the system’s open function,
with its platform specific bugs and limitations.
The symbols provided in the Gnulib namespace are those for which the
corresponding header file contains a _GL_CXXALIAS_RPL or
_GL_CXXALIAS_SYS macro invocation.
The benefits of this namespace mode are:
open has to be overridden, Gnulib normally does
#define open rpl_open. If your package has a class with a member
open, for example a class foo with a method foo::open,
then if you define this member in a compilation unit that includes
<fcntl.h> and use it in a compilation unit that does not include
<fcntl.h>, or vice versa, you will get a link error. Worse: You
will not notice this problem on the platform where the system’s open
function works fine. This problem goes away in namespace mode.
gnulib::open in your code, and you forgot to request the module
‘open’ from Gnulib, you will get a compilation error (regardless of
the platform).
The drawback of this namespace mode is that the system provided symbols in
the global namespace are still present, even when they contain bugs that
Gnulib fixes. For example, if you call open (...) in your code,
it will invoke the possibly buggy system function, even if you have
requested the module ‘open’ from gnulib-tool.
You can turn on the namespace mode in some compilation units and keep it turned off in others. This can be useful if your package consists of an application layer that does not need to invoke POSIX functions and an operating system interface layer that contains all the OS function calls. In such a situation, you will want to turn on the namespace mode for the application layer—to avoid many preprocessor macro definitions—and turn it off for the OS interface layer—to avoid the drawback of the namespace mode, mentioned above.
Next: License Texinfo sources, Previous: A C++ namespace for gnulib, Up: Miscellaneous Notes [Contents][Index]
For projects written in C or similar languages, running the self-tests
under Valgrind can reveal hard to find memory issues. The
valgrind-tests module searches for Valgrind and declares the
VALGRIND automake variable for use with automake’s
TESTS_ENVIRONMENT.
After importing the valgrind-tests module to your project, you
use it by adding the following to the Makefile.am that runs the
self-tests:
TESTS_ENVIRONMENT = $(VALGRIND)
This will run all self-checks under valgrind. This can be wasteful if you have many shell scripts or other non-binaries. Using the Automake parallel-tests feature, this can be avoided by using the following instead:
AUTOMAKE_OPTIONS = parallel-tests TEST_EXTENSIONS = .pl .sh LOG_COMPILER = $(VALGRIND)
Then valgrind will only be used for the non-.sh and non-.pl tests. However, this means that binaries invoked through scripts will not be invoked under valgrind, which could be solved by adding the following:
TESTS_ENVIRONMENT = VALGRIND='$(VALGRIND)'
And then modify the shell scripts to invoke the binary prefixed with
$VALGRIND.
Next: Building gnulib, Previous: Running self-tests under valgrind, Up: Miscellaneous Notes [Contents][Index]
Gnulib provides copies of the GNU GPL, GNU LGPL, and GNU FDL licenses
in Texinfo form. (The master location is
https://www.gnu.org/licenses/). These Texinfo documents do not
have any node names and structures built into them; for your manual,
you should @include them in an appropriate @node.
The conventional name for the GPL node is ‘Copying’ and for the FDL ‘GNU Free Documentation License’. The LGPL doesn’t seem to have a conventional node name.
Of course the license texts themselves should not be changed at all.
Previous: License Texinfo sources, Up: Miscellaneous Notes [Contents][Index]
If you wish to help the gnulib development effort with build logs for your favorite platform, you may perform these steps:
Install the proper development tools. To build and test all of
Gnulib, you will need development tools for the programming languages
C, C++, Java, and Perl, along with standard POSIX utilities such as
awk, make and sh. You will also need
development tools that include Autoconf, Automake, Bison, Gettext,
Git, GNU M4, Gperf, Libtool, and Texinfo. Some of these tools are
needed only by some modules. More details can be found in Gnulib’s
DEPENDENCIES file.
See https://www.gnu.org/software/gnulib/ for how to get the current Gnulib sources via Git.
On a machine with GNU development tools installed and with a gnulib git checkout, use
gnulib-tool --create-megatestdir --with-tests --dir=...
Note: The created directory uses ca. 512 MB on disk.
Transfer this directory to a build machine (HP-UX, Cygwin, or whatever). Often it is easier to transfer one file, and this can be achieved by running, inside the directory the following commands:
./configure make dist
And then transferring the dummy-0.tar.gz file.
On the build machine, run ./do-autobuild (or "nohup ./do-autobuild"). It creates a directory logs/ with a log file for each module.
Next: ISO C and POSIX Header File Substitutes, Previous: Miscellaneous Notes, Up: GNU Gnulib [Contents][Index]
This section shows a radically different way to use Gnulib.
You can extract the ISO C / POSIX substitutes part of gnulib by running the command
gnulib-tool --create-testdir --source-base=lib \
--dir=/tmp/posixlib `posix-modules`
The command ‘posix-modules’ is found in the same directory as
gnulib-tool.
The resulting directory can be built on a particular platform,
independently of the program being ported. Then you can configure and
build any program, by setting CPPFLAGS and LDFLAGS at
configure time accordingly: set CPPFLAGS="-I.../posixlib/lib", plus
any essential type definitions and flags that you find in
.../posixlib/config.h, and set
LDFLAGS=".../posixlib/lib/libgnu.a".
This way of using Gnulib is useful when you don’t want to modify the program’s
source code, or when the program uses a mix between C and C++ sources
(requiring separate builds of the posixlib for the C compiler and
for the C++ compiler).
Next: ISO C and POSIX Function Substitutes, Previous: Building the ISO C and POSIX Substitutes, Up: GNU Gnulib [Contents][Index]
This chapter describes which header files specified by ISO C or POSIX are substituted by Gnulib, which portability pitfalls are fixed by Gnulib, and which (known) portability problems are not worked around by Gnulib.
The notation “Gnulib module: —” means that Gnulib does not provide a
module providing a substitute for the header file. When the list
“Portability problems not fixed by Gnulib” is empty, such a module is
not needed: No portability problems are known. Otherwise, it indicates
that such a module would be useful but is not available: No one so far
found this header file important enough to contribute a substitute for it.
If you need this particular header file, you may write to
<bug-gnulib at gnu dot org>.
Next: arpa/inet.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/aio.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: assert.h, Previous: aio.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/arpa_inet.h.html
Gnulib module: arpa_inet
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: complex.h, Previous: arpa/inet.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/assert.h.html
Gnulib module: assert-h
See also the Gnulib module assert.
Portability problems fixed by Gnulib:
static_assert, and the C11
_Static_assert, are not supported by many platforms.
For example, GCC versions before 4.6.0 do not support _Static_assert,
and G++ versions through at least 4.6.0 do not support static_assert.
Portability problems not fixed by Gnulib:
_Static_assert and C++11 static_assert
are keywords that can be used without including <assert.h>.
The Gnulib substitutes are macros that require including <assert.h>.
static_assert and _Static_assert can also
be used within a struct or union specifier, in place of
an ordinary declaration of a member of the struct or union. The
Gnulib substitute can be used only as an ordinary declaration.
assert can be applied to any scalar expression.
In C89, the argument to assert is of type int.
Next: cpio.h, Previous: assert.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/complex.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctype.h, Previous: complex.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/cpio.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dirent.h, Previous: cpio.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/ctype.h.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlfcn.h, Previous: ctype.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/dirent.h.html
Gnulib module: dirent
Portability problems fixed by Gnulib:
ino_t is missing on some platforms:
glibc 2.23 and others.
Portability problems not fixed by Gnulib:
struct dirent member named
d_type and directory entry type macros like DT_DIR and
DT_LNK, some do not:
Minix 3.1.8, AIX 7.2, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 11.3, mingw, Interix 3.5, BeOS.
d_type, not every filesystem supports
d_type, and those lacking support will set it to DT_UNKNOWN.
struct dirent member named d_namlen
containing the string length of d_name, but others do not:
glibc 2.23 on Linux, Minix 3.1.8, Solaris 11.3, Cygwin, BeOS.
All of these, except Cygwin, have a member d_reclen instead,
that has a different semantics.
struct dirent member named d_off
containing a magic cookie suitable as an argument to seekdir,
but others do not:
glibc 2.23 on Hurd, Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, AIX 5.1, HP-UX 11, OSF/1 5.1, Cygwin, mingw, Interix 3.5, BeOS.
struct dirent member named
d_reclen containing the number of bytes in the directory entry
record, but others do not. This member has limited utility, as it is
an implementation detail.
Next: errno.h, Previous: dirent.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/dlfcn.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fcntl.h, Previous: dlfcn.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/errno.h.html
Gnulib module: errno
Portability problems fixed by Gnulib:
EOVERFLOW, ENOLINK are not defined
on some platforms:
OpenBSD 4.0, OSF/1 5.1, mingw, MSVC 9.
EMULTIHOP is not defined
on some platforms:
OpenBSD 4.0, OSF/1 5.1, mingw, MSVC 14.
ECANCELED is not defined on some platforms:
OpenBSD 4.0, Cygwin, mingw, MSVC 9.
ENOMSG, EIDRM, EPROTO, EBADMSG,
ENOTSUP are not defined on some platforms:
OpenBSD 4.0, mingw, MSVC 9.
ESTALE is not defined on some platforms:
mingw, MSVC 14, Interix 3.5.
EDQUOT is not defined on some platforms:
NonStop Kernel, mingw, MSVC 14.
ENETRESET, ECONNABORTED are not defined on some
platforms:
Minix 3.1.8, mingw, MSVC 9.
EWOULDBLOCK, ETXTBSY, ELOOP, ENOTSOCK,
EDESTADDRREQ, EMSGSIZE, EPROTOTYPE, ENOPROTOOPT,
EPROTONOSUPPORT, EOPNOTSUPP, EAFNOSUPPORT,
EADDRINUSE, EADDRNOTAVAIL, ENETDOWN, ENETUNREACH,
ECONNRESET, ENOBUFS, EISCONN, ENOTCONN,
ETIMEDOUT, ECONNREFUSED, EHOSTUNREACH, EALREADY,
EINPROGRESS are not defined on some platforms:
mingw, MSVC 9.
EOWNERDEAD, ENOTRECOVERABLE are not defined on
some platforms:
glibc/Linux 2.3.6, glibc/Hurd 2.15, glibc/kFreeBSD 2.15,
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, Minix 3.1.8, AIX 5.1, HP-UX 11, IRIX 6.5, OSF/1 5.1, Cygwin, mingw without pthreads-win32, MSVC 9, Interix 3.5, BeOS.
EILSEQ is not defined on some platforms:
LynxOS 178 2.2.2.
Portability problems not fixed by Gnulib:
Next: fenv.h, Previous: errno.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/fcntl.h.html
Gnulib module: fcntl-h
Portability problems fixed by Gnulib:
pid_t is not defined on some platforms:
MSVC 14.
mode_t is not defined on some platforms:
MSVC 14.
int on some platforms:
AIX 7.1 with XL C 12.1.
int on some
platforms:
Solaris 11.3.
Portability problems not fixed by Gnulib:
Next: float.h, Previous: fcntl.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/fenv.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmtmsg.h, Previous: fenv.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/float.h.html
Gnulib module: float
Portability problems fixed by Gnulib:
int to long double in incorrect on some
platforms:
glibc 2.7 on Linux/SPARC64.
LDBL_* macros are incorrect on some platforms:
On OpenBSD 4.0, MirBSD 10, and BeOS, they are the same as the values of the
DBL_* macros, although ‘long double’ is a larger type than
‘double’.
On FreeBSD/x86 6.4, they represent the incorrect 53-bit precision assumptions
in the compiler, not the real 64-bit precision at runtime.
On Linux/PowerPC with GCC 4.4, on AIX 7.1 with GCC 4.2, and on IRIX 6.5,
they don’t reflect the “double double” representation of long double
correctly.
Portability problems not fixed by Gnulib:
FLT_ROUNDS is a constant expression and does not represent
the current rounding mode on some platforms:
glibc 2.11, HP-UX 11, mingw.
Next: fnmatch.h, Previous: float.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/fmtmsg.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ftw.h, Previous: fmtmsg.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/fnmatch.h.html
Gnulib module: fnmatch-posix or fnmatch-gnu
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: glob.h, Previous: fnmatch.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/ftw.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: grp.h, Previous: ftw.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/glob.h.html
Gnulib module: glob
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: iconv.h, Previous: glob.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/grp.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inttypes.h, Previous: grp.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/iconv.h.html
Gnulib module: iconv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: iso646.h, Previous: iconv.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/inttypes.h.html
Gnulib module: inttypes
Portability problems fixed by Gnulib:
imaxabs and imaxdiv are missing on some
platforms:
NetBSD 3.0, OpenBSD 3.8, AIX 5.1, HP-UX 11, IRIX 6.5, OSF/1 5.1, BeOS.
strtoimax and strtoumax are missing on some
platforms:
OpenBSD 3.8, AIX 4.3.2, AIX 5.1 (missing only strtoumax), OSF/1 5.1.
__STDC_FORMAT_MACROS to make visible the declarations of format
macros such as PRIdMAX.
Portability problems not fixed by Gnulib:
Next: langinfo.h, Previous: inttypes.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/iso646.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: libgen.h, Previous: iso646.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/langinfo.h.html
Gnulib module: langinfo
Portability problems fixed by Gnulib:
CODESET is not defined on some platforms:
glibc 2.0.6, OpenBSD 3.8.
ALTMON_1 to ALTMON_12 are not defined on some
platforms:
glibc 2.26 and many others.
ERA, ERA_D_FMT, ERA_D_T_FMT,
ERA_T_FMT, ALT_DIGITS are not defined on some platforms:
OpenBSD 3.8.
T_FMT_AMPM, YESEXPR, NOEXPR are not
defined on some platforms:
IRIX 5.3.
Portability problems not fixed by Gnulib:
Next: limits.h, Previous: langinfo.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/libgen.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
The Gnulib module dirname provides similar API, with functions
base_name and dir_name that also work with Windows file names.
Next: locale.h, Previous: libgen.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/limits.h.html
Gnulib module: gethostname
Portability problems fixed by Gnulib:
HOST_NAME_MAX macro is not defined on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, AIX 5.1, HP-UX 11,
IRIX 6.5, OSF/1 5.1, Solaris 11.3, Cygwin 1.5.x, mingw, MSVC 14, Interix 3.5, BeOS.
CHAR_WIDTH are not defined on some platforms:
glibc 2.24, many others.
Portability problems not fixed by Gnulib:
LLONG_MIN, LLONG_MAX, ULLONG_MAX are not
defined on some platforms:
AIX 5.1, HP-UX 11, IRIX 6.5, OpenVMS, OSF/1 5.1 with gcc.
WORD_BIT, LONG_BIT are not defined on some platforms:
glibc 2.11 without -D_GNU_SOURCE, Cygwin, mingw, MSVC 14.
SSIZE_MAX has the wrong type,
albeit with the correct value:
32-bit glibc 2.24 (on some architectures), Cygwin 2.5.2.
SSIZE_MAX is not defined on some platforms:
MSVC 14.
For PATH_MAX, Gnulib provides a module pathmax with a header
file "pathmax.h". It defines PATH_MAX to a constant on
platforms with a file name length limit.
Next: math.h, Previous: limits.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/locale.h.html
Gnulib module: locale
Portability problems fixed by Gnulib:
locale_t type is not defined on some platforms:
glibc 2.11, Mac OS X 10.5.
struct lconv type does not contain any members on some platforms:
Android up to 2014.
struct lconv type does not contain the members
int_p_cs_precedes, int_p_sign_posn, int_p_sep_by_space,
int_n_cs_precedes, int_n_sign_posn, int_n_sep_by_space
on some platforms:
glibc, OpenBSD 4.9, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 11.3, Cygwin 1.5.x, mingw, MSVC 14.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
Next: monetary.h, Previous: locale.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/math.h.html
Gnulib module: math
Portability problems fixed by Gnulib:
int to long double in incorrect on some
platforms:
glibc 2.7 on Linux/SPARC64.
NAN is not defined on some platforms:
OpenBSD 4.0, AIX 5.1, IRIX 6.5, OSF/1 5.1.
NAN is not exposed outside of C99 compilation on some
platforms:
glibc.
NAN and HUGE_VAL expand to a function address
rather than a floating point constant on some platforms:
Solaris 10.
HUGE_VALF and HUGE_VALL are not defined on some
platforms:
glibc/HPPA, glibc/SPARC, AIX 5.1, IRIX 6.5, Solaris 9, MSVC 9.
FP_ILOGB0 and FP_ILOGBNAN are not defined on some
platforms:
NetBSD 5.1, AIX 5.1, IRIX 6.5, Solaris 9, MSVC 9.
FP_ILOGB0 and FP_ILOGBNAN have wrong values on some
platforms:
Haiku 2017.
NAN, HUGE_VALL, and INFINITY are not
defined on some platforms:
OpenVMS.
Portability problems not fixed by Gnulib:
NAN is not a compile time constant with some compilers:
OSF/1 with Compaq (ex-DEC) C 6.4, OpenVMS.
math_errhandling is not defined on some platforms:
glibc 2.11, OpenBSD 4.9, NetBSD 5.1, UP-UX 11, IRIX 6.5, OSF/1 5.1, Cygwin 1.7.9, mingw, MSVC 9.
Next: mqueue.h, Previous: math.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/monetary.h.html
Gnulib module: monetary
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ndbm.h, Previous: monetary.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/mqueue.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: net/if.h, Previous: mqueue.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/ndbm.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: netdb.h, Previous: ndbm.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/net_if.h.html
Gnulib module: net_if
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: netinet/in.h, Previous: net/if.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/netdb.h.html
Gnulib module: netdb
Portability problems fixed by Gnulib:
socklen_t on some platforms:
HP-UX 10.20, IRIX 6.5, OSF/1 4.0, Interix 3.5, BeOS.
AI_ALL, AI_V4MAPPED,
AI_ADDRCONFIG on some platforms:
NetBSD 5.0.
Portability problems not fixed by Gnulib:
Next: netinet/tcp.h, Previous: netdb.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/netinet_in.h.html
Gnulib module: netinet_in
Portability problems fixed by Gnulib:
<sys/types.h> to be included first):
OpenBSD 4.6.
Portability problems not fixed by Gnulib:
Next: nl_types.h, Previous: netinet/in.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/netinet_tcp.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: poll.h, Previous: netinet/tcp.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/nl_types.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread.h, Previous: nl_types.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/poll.h.html
Gnulib module: poll-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
nfds_t on some platforms:
IRIX 5.3.
Next: pwd.h, Previous: poll.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/pthread.h.html
Gnulib module: pthread
Portability problems fixed by Gnulib:
strtok_r and
gmtime_r:
mingw 3.0.
Portability problems not fixed by Gnulib:
pthread_atfork on some
platforms:
IRIX 6.5.
Next: regex.h, Previous: pthread.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/pwd.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched.h, Previous: pwd.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/regex.h.html
Gnulib module: regex
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<sys/types.h> to be included first.
Next: search.h, Previous: regex.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sched.h.html
Gnulib module: sched
Portability problems fixed by Gnulib:
pid_t on some platforms:
glibc 2.11, Mac OS X 10.5.
struct sched_param is not defined on some platforms:
Haiku.
SCHED_FIFO, SCHED_RR, SCHED_OTHER are not defined on
some platforms:
Haiku.
Portability problems not fixed by Gnulib:
Next: semaphore.h, Previous: sched.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/search.h.html
Gnulib module: search
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setjmp.h, Previous: search.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/semaphore.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: signal.h, Previous: semaphore.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/setjmp.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: spawn.h, Previous: setjmp.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/signal.h.html
Gnulib module: signal-h
Portability problems fixed by Gnulib:
volatile sig_atomic_t is rejected by older compilers on some
platforms:
AIX.
sigset_t is missing on some platforms:
MSVC 14.
sigset_t is only declared in <sys/types.h> on some platforms:
mingw.
struct sigaction and siginfo_t are missing on some
platforms:
mingw, MSVC 14.
struct sigaction lacks the sa_sigaction member on some
platforms:
Irix 5.3, Interix 3.5.
pid_t is not defined on some platforms:
MSVC 14.
SIGPIPE is not defined on some platforms:
mingw, MSVC 14.
SA_NODEFER is not defined on some platforms:
Interix 3.5.
SA_RESETHAND and SA_RESTART are not defined
on some platforms:
NonStop.
sighandler_t (a GNU extension) is not defined on most non-glibc
platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, AIX 5.1, HP-UX 11,
IRIX 6.5, OSF/1 5.1, Solaris 11.3, Cygwin, mingw, MSVC 14, Interix 3.5, BeOS.
Portability problems not fixed by Gnulib:
SIGRTMIN and SIGRTMAX expand to an expression of type
long instead of int on some platforms:
OSF/1 5.1.
SIGBUS is set to the same value as SIGSEGV,
rather than being a distinct signal, on some platforms:
Haiku.
Next: stdalign.h, Previous: signal.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/spawn.h.html
Gnulib module: spawn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: stdarg.h, Previous: spawn.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
Not in POSIX yet, but we expect it will be.
ISO C11 (latest free draft
http://www.open-std.org/jtc1/sc22/wg14/www/docs/n1570.pdf)
sections 6.5.3.4, 6.7.5, 7.15.
C++11 (latest free draft
http://www.open-std.org/jtc1/sc22/wg21/docs/papers/2011/n3242.pdf)
section 18.10.
Gnulib module: stdalign
Portability problems fixed by Gnulib:
<stdalign.h> does not define alignof/_Alignof.
alignof and _Alignof macros return too large values for
the types double and long long in GCC 4.7.0.
Portability problems not fixed by Gnulib:
alignof/_Alignof must be a
parenthesized type. Recent versions of GCC support an extension in
which the operand can also be a unary expression, as with
sizeof. The Gnulib substitute does not support this extension.
alignof/_Alignof cannot be a structure type containing a
flexible array member.
_Alignas and alignas are not always supported;
on platforms lacking support, the
macro __alignas_is_defined is not defined.
Supported compilers include GCC, IBM C, Sun C 5.9 and later,
and MSVC 7.0 and later.
alignas/_Alignas of auto variables (i.e.,
variables on the stack). They diagnose and ignore the alignment: Sun
C 5.11.
_Alignas/alignas
that are greater than 8: mingw.
_Alignas/alignas
to be a single integer constant, not an expression: MSVC 7.0 through
at least 10.0.
_Alignas/alignas. This compiler bug causes the Gnulib
module stdalign-tests to fail. The Sun Studio Developer Bug
Report Review Team assigned the internal review ID 2125432 (dated
2011-11-01) to this issue.
<stdalign.h> must be #included before _Alignas and
_Alignof can be used.
_Alignas and _Alignof are reserved words;
they might be macros.
Next: stdbool.h, Previous: stdalign.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stdarg.h.html
Gnulib module: stdarg
Portability problems fixed by Gnulib:
va_copy to work.
Portability problems not fixed by Gnulib:
Next: stddef.h, Previous: stdarg.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stdbool.h.html
Gnulib module: stdbool
Portability problems fixed by Gnulib:
true incorrectly on some platforms:
OpenBSD 4.7 with gcc 2.95.
Portability problems not fixed by Gnulib:
<stdbool.h> is included, or if
the program is intended to be compiled by a C++ compiler.
_Bool is a typedef; it might be a macro.
Next: stdint.h, Previous: stdbool.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stddef.h.html
Gnulib module: stddef
Portability problems fixed by Gnulib:
max_align_t, which was added in C11:
Solaris 11.0 and others.
wchar_t.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
offsetof macro that cannot be used in
arbitrary expressions:
Solaris 11.3
This problem can be worked around by parenthesizing the
offsetof expression in the unlikely case you use it with
sizeof or ‘[]’.
Next: stdio.h, Previous: stddef.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stdint.h.html
Gnulib module: stdint
Portability problems fixed by Gnulib:
SIG_ATOMIC_MIN and SIG_ATOMIC_MAX are incorrect
on some platforms:
FreeBSD 6.2 / ia64.
WINT_MAX is incorrect on some platforms:
mingw.
INT8_MAX, UINT8_MAX etc. are not usable in
preprocessor expressions on some platforms:
HP-UX 11.23.
INTPTR_MAX and UINTPTR_MAX, although correctly
defined in <stdint.h>, are replaced by empty values when
<limits.h> or <inttypes.h> gets included later on some platforms:
Solaris 9 with GCC 4.5 or newer.
WCHAR_MIN and WCHAR_MAX are not defined in
<stdint.h> (only in <wchar.h>) on some platforms:
Dragonfly, BSDI.
__STDC_CONSTANT_MACROS to make visible the definitions of
constant macros such as INTMAX_C, and one must define
__STDC_LIMIT_MACROS to make visible the definitions of limit
macros such as INTMAX_MAX.
SIZE_MAX has the wrong type,
albeit with the correct value:
32-bit glibc 2.24 (on s390 architecture), Mac OS X 10.7.
INTMAX_WIDTH are not defined on some platforms:
glibc 2.24, many others.
Portability problems not fixed by Gnulib:
{uint,int}_fast{8,16,32,64}_t may not correspond to the fastest
types available on the system.
Other <stdint.h> substitutes may define these types differently,
so public header files should avoid these types.
long int.
For example, as of 2007, Sun C mishandles #if LLONG_MIN < 0 on
a platform with 32-bit long int and 64-bit long long int.
Some older preprocessors mishandle constants ending in LL.
To work around these problems, compute the value of expressions like
LONG_MAX < LLONG_MAX at configure-time rather than at
#if-time.
The stdint.h module uses #include_next. If you wish to install
the generated stdint.h file under another name, typically in order to
be able to use some of the types defined by stdint.h in your public
header file, you could use the following Makefile.am-snippet:
BUILT_SOURCES += idn-int.h DISTCLEANFILES += idn-int.h nodist_include_HEADERS += idn-int.h idn-int.h: if test -n "$(STDINT_H)"; then \ sed -e s/include_next/include/ gl/stdint.h > idn-int.h; \ else \ echo '#include <stdint.h>' > idn-int.h; \ fi
Next: stdlib.h, Previous: stdint.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stdio.h.html
Gnulib module: stdio
Portability problems fixed by Gnulib:
off_t is missing on some platforms:
glibc 2.8, eglibc 2.11.2 and others.
ssize_t is missing on some platforms:
glibc 2.8, Mac OS X 10.5, Solaris 10, MSVC 14, and others.
va_list is missing on some platforms:
glibc 2.8, OpenBSD 4.0, Solaris 11.3, and others.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
Next: stdnoreturn.h, Previous: stdio.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stdlib.h.html
Gnulib module: stdlib, system-posix
Portability problems fixed by the Gnulib module stdlib:
EXIT_SUCCESS and EXIT_FAILURE are not defined on
some platforms.
EXIT_FAILURE is incorrectly defined on Tandem/NSK.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems fixed by the Gnulib module system-posix:
WIFSIGNALED, WIFEXITED, WIFSTOPPED,
WTERMSIG, WEXITSTATUS, WNOHANG, WUNTRACED,
WSTOPSIG are not defined in this header file (only in
<sys/wait.h>) on some platforms:
MirBSD 10.
Portability problems not fixed by Gnulib:
WEXITSTATUS require an lvalue
argument on some platforms.
Mac OS X 10.5.
Next: string.h, Previous: stdlib.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
Not in POSIX yet, but we expect it will be.
ISO C11 (latest free draft
http://www.open-std.org/jtc1/sc22/wg14/www/docs/n1570.pdf)
sections 7.23.
Gnulib module: stdnoreturn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<stdnoreturn.h> should be #included before ‘_Noreturn’ is used.
_Noreturn is a reserved word;
it might be a macro.
lint is defined, standard headers define
_Noreturn (and therefore noreturn) to be a macro that
expands to the empty token sequence on some platforms:
Cygwin 2.5.1, FreeBSD 10.3.
noreturn expands to the empty token
sequence, to avoid problems with standard headers that use noreturn
in combination with __attribute__ or __declspec. Although
the resulting code operates correctly, the compiler is not informed whether
noreturn functions do not return, so it may generate incorrect
warnings at compile-time, or code that is slightly less optimized. This
problem does not occur with _Noreturn.
-Werror=old-style-declaration
requires _Noreturn or noreturn before the returned type
in a declaration, and therefore rejects valid but unusually-worded
declarations such as void _Noreturn foo (void);.
Next: strings.h, Previous: stdnoreturn.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/string.h.html
Gnulib module: string
Portability problems fixed by Gnulib:
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
Next: stropts.h, Previous: string.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/strings.h.html
Gnulib module: strings
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/ipc.h, Previous: strings.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/stropts.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/mman.h, Previous: stropts.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_ipc.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/msg.h, Previous: sys/ipc.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_mman.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/resource.h, Previous: sys/mman.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_msg.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/select.h, Previous: sys/msg.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_resource.h.html
Gnulib module: sys_resource
Portability problems fixed by Gnulib:
RUSAGE_SELF and
RUSAGE_CHILDREN constants:
OpenVMS.
Portability problems not fixed by Gnulib:
RLIM_SAVED_CUR or RLIM_SAVED_MAX.
Next: sys/sem.h, Previous: sys/resource.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_select.h.html
Gnulib module: sys_select
Portability problems fixed by Gnulib:
<sys/types.h> to be included first.
struct timeval on some platforms:
OSF/1 4.0.
<string.h>
before FD_ZERO can be used—on some platforms:
AIX 7.1, Solaris 11.3.
Portability problems not fixed by Gnulib:
Next: sys/shm.h, Previous: sys/select.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_sem.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/socket.h, Previous: sys/sem.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_shm.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/stat.h, Previous: sys/shm.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_socket.h.html
Gnulib module: sys_socket
Portability problems fixed by Gnulib:
<sys/types.h> to be included first.
socklen_t on some platforms:
HP-UX 10.20, IRIX 6.5, OSF/1 4.0, Interix 3.5, BeOS.
struct iovec on some platforms:
OpenBSD 4.4.
SHUT_RD, SHUT_WR,
SHUT_RDWR macros on some platforms, despite having the shutdown
functions:
emx+gcc.
struct sockaddr_storage type does not have a member ss_family
on some platforms:
AIX 7.1.
CMSG_SPACE and CMSG_LEN macros are not provided on some
platforms:
OpenVMS.
SO_REUSEPORT macro on some
platforms:
Minix 3.1.8, Solaris 10, Cygwin, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
msg_control and
msg_controllen members of struct msghdr on some
platforms. This can be detected by the absence of the
CMSG_FIRSTHDR macro:
gnulib replacement header, old BSD
Next: sys/statvfs.h, Previous: sys/socket.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_stat.h.html
Gnulib module: sys_stat
Portability problems fixed by Gnulib module sys_stat:
mode_t is not defined on some platforms:
MSVC 14.
S_IFMT or S_IFIFO, are missing on some
platforms.
S_ISBLK, S_ISCHR, S_ISDIR, S_ISFIFO,
S_ISLNK, S_ISREG, S_ISSOCK are broken on some platforms.
S_ISDOOR, that are not defined
on other platforms.
lstat and mkdir are not declared on some platforms:
mingw, MSVC 14.
UTIME_NOW and UTIME_OMIT are missing on some
platforms.
struct stat does not include st_atim,
st_mtim, or st_ctim members. Use the gnulib module
‘stat-time’ for accessors to portably get at subsecond resolution.
Portability problems fixed by Gnulib module sys_stat, together with module windows-stat-inodes:
st_ino is always 0.
Portability problems not fixed by Gnulib:
S_IFBLK is missing on some platforms:
MSVC 14.
st_ino is an array of three ino_t values,
not a single value.
st_ino and use the Gnulib same-inode module to
compare nonzero values. For example, SAME_INODE (a, b)
is true if the struct stat values a and
b are known to represent the same file, (a.st_ino &&
!SAME_INODE (a, b)) is true if they are known to represent different
files, and !a.st_ino is true if it is not known whether they
represent different files.
st_dev
and st_ino values, even when st_ino is nonzero:
st_dev exceeds 255, or if a local
st_ino exceeds 16777215.
One partial workaround is to compare other file metadata such as
st_mode and st_mtime to detect this bug, but this
approach does not work on files whose metadata are being changed by
other programs.
st_size contains bogus information for
symlinks; use the Gnulib module areadlink-with-size for a
better way to get symlink contents.
Next: sys/time.h, Previous: sys/stat.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_statvfs.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/timeb.h, Previous: sys/statvfs.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_time.h.html
Gnulib module: sys_time
Portability problems fixed by Gnulib:
tv_sec type that is
narrower than time_t
on some native Windows platforms:
mingw64 in 64-bit mode,
mingw64 in 32-bit mode when __MINGW_USE_VC2005_COMPAT is defined,
MSVC 14 in 64-bit mode,
MSVC 14 in 32-bit mode when _USE_32BIT_TIME_T is not defined.
Portability problems not fixed by Gnulib:
tv_sec type that is
wider than time_t:
OpenBSD 5.1 in 64-bit mode.
Next: sys/times.h, Previous: sys/time.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/susv3xbd/sys/timeb.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/types.h, Previous: sys/timeb.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_times.h.html
Gnulib module: sys_times
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/uio.h, Previous: sys/times.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_types.h.html
Gnulib module: sys_types
Portability problems fixed by Gnulib:
pid_t is not defined on some platforms:
MSVC 14.
size_t is not defined in this file on some platforms:
MSVC 14.
ssize_t is not defined on some platforms:
MSVC 14.
mode_t is not defined on some platforms:
MSVC 14.
major, minor, and
makedev through this header; however, when
sys/sysmacros.h exists, that file should also be included to
avoid deprecation warnings from the versions in this header:
glibc 2.25.
Portability problems not fixed by Gnulib:
blksize_t and suseconds_t
are signed integer types that are wider than long:
glibc x32
This module, together with the module largefile, also defines the type
off_t to a 64-bit integer type on some platforms:
mingw, MSVC 14.
Next: sys/un.h, Previous: sys/types.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_uio.h.html
Gnulib module: sys_uio
Portability problems fixed by Gnulib:
<sys/types.h> to be
included first) on some platforms:
OpenBSD 4.4.
Portability problems not fixed by Gnulib:
Next: sys/utsname.h, Previous: sys/uio.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_un.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/wait.h, Previous: sys/un.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_utsname.h.html
Gnulib module: sys_utsname
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: syslog.h, Previous: sys/utsname.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/sys_wait.h.html
Gnulib module: sys_wait
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
WEXITSTATUS require an lvalue
argument on some platforms.
Mac OS X 10.5.
Next: tar.h, Previous: sys/wait.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/syslog.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: termios.h, Previous: syslog.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/tar.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tgmath.h, Previous: tar.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/termios.h.html
Gnulib module: termios
Portability problems fixed by Gnulib:
pid_t on all platforms:
glibc on some architectures, FreeBSD 6.4, OpenBSD 4.9, Cygwin 1.7.11.
Portability problems not fixed by Gnulib:
struct termios, cc_t, speed_t, tcflag_t
are not defined on some platforms:
mingw, MSVC 14.
Next: time.h, Previous: termios.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/tgmath.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: trace.h, Previous: tgmath.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/time.h.html
Gnulib module: time
Portability problems fixed by Gnulib:
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
tv_nsec member of struct timespec
is not of type long, but is of type long long instead:
glibc x32
Next: uchar.h, Previous: time.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/trace.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ucontext.h, Previous: trace.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
Defines the types char16_t, char32_t and declares the
functions mbrtoc16, c16rtomb, mbrtoc32,
c32rtomb.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ulimit.h, Previous: uchar.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/susv3xbd/ucontext.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: unistd.h, Previous: ucontext.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/ulimit.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: utime.h, Previous: ulimit.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/unistd.h.html
Gnulib module: unistd
Portability problems fixed by Gnulib:
_exit function is not declared in this file on some platforms:
mingw.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
Next: utmpx.h, Previous: unistd.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/utime.h.html
Gnulib module: utime-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: wchar.h, Previous: utime.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/utmpx.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: wctype.h, Previous: utmpx.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/wchar.h.html
Gnulib module: wchar
Portability problems fixed by Gnulib:
wint_t and macro WEOF are missing on some platforms:
IRIX 5.3.
wint_t is incorrect on some platforms:
MSVC 14.
NULL macro that cannot be used in arbitrary
expressions:
NetBSD 5.0
Portability problems not fixed by Gnulib:
Next: wordexp.h, Previous: wchar.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/wctype.h.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
wint_t and macro WEOF are missing on some platforms:
IRIX 5.3.
wint_t is incorrect on some platforms:
MSVC 14.
isw* are missing on some platforms:
FreeBSD 4.11.
iswblank is declared but not defined on some platforms:
IRIX 6.5.30.
isw* are actually defined as macros that don’t work,
on IRIX 5.3.
multibyte, as macros
on some platforms:
Solaris 2.6.
Portability problems not fixed by Gnulib:
Previous: wctype.h, Up: ISO C and POSIX Header File Substitutes [Contents][Index]
POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/basedefs/wordexp.h.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Past POSIX Function Substitutes, Previous: ISO C and POSIX Header File Substitutes, Up: GNU Gnulib [Contents][Index]
This chapter describes which functions and function-like macros specified by ISO C or POSIX are substituted by Gnulib, which portability pitfalls are fixed by Gnulib, and which (known) portability problems are not worked around by Gnulib.
The notation “Gnulib module: —” means that Gnulib does not provide a
module providing a substitute for the function. When the list
“Portability problems not fixed by Gnulib” is empty, such a module is
not needed: No portability problems are known. Otherwise, it indicates
that such a module would be useful but is not available: No one so far
found this function important enough to contribute a substitute for it.
If you need this particular function, you may write to
<bug-gnulib at gnu dot org>.
FD_CLRFD_ISSETFD_SETFD_ZERO_Exit_exit_longjmp_setjmp_tolower_touppera64labortabsacceptaccessacosacosfacoshacoshfacoshlacoslaio_cancelaio_erroraio_fsyncaio_readaio_returnaio_suspendaio_writealarmaligned_allocalphasortasctimeasctime_rasinasinfasinhasinhfasinhlasinlassertatanatan2atan2fatan2latanfatanhatanhfatanhlatanlatexitatofatoiatolatollbasenamebindbsearchbtowcc16rtombc32rtombcabscabsfcabslcacoscacosfcacoshcacoshfcacoshlcacoslcalloccargcargfcarglcasincasinfcasinhcasinhfcasinhlcasinlcatancatanfcatanhcatanhfcatanhlcatanlcatclosecatgetscatopencbrtcbrtfcbrtlccosccosfccoshccoshfccoshlccoslceilceilfceillcexpcexpfcexplcfgetispeedcfgetospeedcfsetispeedcfsetospeedchdirchmodchowncimagcimagfcimaglclearerrclockclock_getcpuclockidclock_getresclock_gettimeclock_nanosleepclock_settimeclogclogfcloglcloseclosedircloselogconfstrconjconjfconjlconnectcopysigncopysignfcopysignlcoscosfcoshcoshfcoshlcoslcpowcpowfcpowlcprojcprojfcprojlcrealcrealfcreallcreatcryptcsincsinfcsinhcsinhfcsinhlcsinlcsqrtcsqrtfcsqrtlctanctanfctanhctanhfctanhlctanlctermidctimectime_rdaylightdbm_clearerrdbm_closedbm_deletedbm_errordbm_fetchdbm_firstkeydbm_nextkeydbm_opendbm_storedifftimedirfddirnamedivdlclosedlerrordlopendlsymdprintfdrand48dupdup2duplocaleencryptendgrentendhostentendnetentendprotoentendpwentendserventendutxentenvironerand48erferfcerfcferfclerfferflerrnoexeclexecleexeclpexecvexecveexecvpexitexpexp2exp2fexp2lexpfexplexpm1expm1fexpm1lfabsfabsffabslfaccessatfattachfchdirfchmodfchmodatfchownfchownatfclosefcntlfdatasyncfdetachfdimfdimffdimlfdopenfdopendirfeclearexceptfegetenvfegetexceptflagfegetroundfeholdexceptfeofferaiseexceptferrorfesetenvfesetexceptflagfesetroundfetestexceptfeupdateenvfexecvefflushffsfgetcfgetposfgetsfgetwcfgetwsfilenoflockfilefloorfloorffloorlfmafmaffmalfmaxfmaxffmaxlfmemopenfminfminffminlfmodfmodffmodlfmtmsgfnmatchfopenforkfpathconffpclassifyfprintffputcfputsfputwcfputwsfreadfreefreeaddrinfofreelocalefreopenfrexpfrexpffrexplfscanffseekfseekofsetposfstatfstatatfstatvfsfsyncftellftelloftokftruncateftrylockfileftwfunlockfilefutimensfwidefwprintffwritefwscanfgai_strerrorgetaddrinfogetcgetc_unlockedgetchargetchar_unlockedgetcwdgetdategetdate_errgetdelimgetegidgetenvgeteuidgetgidgetgrentgetgrgidgetgrgid_rgetgrnamgetgrnam_rgetgroupsgethostentgethostidgethostnamegetitimergetlinegetlogingetlogin_rgetmsggetnameinfogetnetbyaddrgetnetbynamegetnetentgetoptgetpeernamegetpgidgetpgrpgetpidgetpmsggetppidgetprioritygetprotobynamegetprotobynumbergetprotoentgetpwentgetpwnamgetpwnam_rgetpwuidgetpwuid_rgetrlimitgetrusagegetsgetservbynamegetservbyportgetserventgetsidgetsocknamegetsockoptgetsuboptgettimeofdaygetuidgetutxentgetutxidgetutxlinegetwcgetwcharglobglobfreegmtimegmtime_rgrantpthcreatehdestroyhsearchhtonlhtonshypothypotfhypotliconviconv_closeiconv_openif_freenameindexif_indextonameif_nameindexif_nametoindexilogbilogbfilogblimaxabsimaxdivinet_addrinet_ntoainet_ntopinet_ptoninitstateinsqueioctlisalnumisalnum_lisalphaisalpha_lisasciiisastreamisattyisblankisblank_liscntrliscntrl_lisdigitisdigit_lisfiniteisgraphisgraph_lisgreaterisgreaterequalisinfislessislessequalislessgreaterislowerislower_lisnanisnormalisprintisprint_lispunctispunct_lisspaceisspace_lisunorderedisupperisupper_liswalnumiswalnum_liswalphaiswalpha_liswblankiswblank_liswcntrliswcntrl_liswctypeiswctype_liswdigitiswdigit_liswgraphiswgraph_liswloweriswlower_liswprintiswprint_liswpunctiswpunct_liswspaceiswspace_liswupperiswupper_liswxdigitiswxdigit_lisxdigitisxdigit_lj0j1jnjrand48killkillpgl64alabslchownlcong48ldexpldexpfldexplldivlfindlgammalgammaflgammallinklinkatlio_listiolistenllabslldivllrintllrintfllrintlllroundllroundfllroundllocaleconvlocaltimelocaltime_rlockfloglog10log10flog10llog1plog1pflog1pllog2log2flog2llogblogbflogbllogflogllongjmplrand48lrintlrintflrintllroundlroundflroundllsearchlseeklstatmallocmblenmbrlenmbrtoc16mbrtoc32mbrtowcmbsinitmbsnrtowcsmbsrtowcsmbstowcsmbtowcmemccpymemchrmemcmpmemcpymemmovememsetmkdirmkdiratmkdtempmkfifomkfifoatmknodmknodatmkstempmktimemlockmlockallmmapmodfmodffmodflmprotectmq_closemq_getattrmq_notifymq_openmq_receivemq_sendmq_setattrmq_timedreceivemq_timedsendmq_unlinkmrand48msgctlmsggetmsgrcvmsgsndmsyncmunlockmunlockallmunmapnannanfnanlnanosleepnearbyintnearbyintfnearbyintlnewlocalenextafternextafterfnextafterlnexttowardnexttowardfnexttowardlnftwnicenl_langinfonl_langinfo_lnrand48ntohlntohsopenopenatopendiropenlogopen_memstreamopen_wmemstreamoptargopterroptindoptoptpathconfpausepcloseperrorpipepollpopenposix_fadviseposix_fallocateposix_madviseposix_mem_offsetposix_memalignposix_openptposix_spawnposix_spawn_file_actions_addcloseposix_spawn_file_actions_adddup2posix_spawn_file_actions_addopenposix_spawn_file_actions_destroyposix_spawn_file_actions_initposix_spawnattr_destroyposix_spawnattr_getflagsposix_spawnattr_getpgroupposix_spawnattr_getschedparamposix_spawnattr_getschedpolicyposix_spawnattr_getsigdefaultposix_spawnattr_getsigmaskposix_spawnattr_initposix_spawnattr_setflagsposix_spawnattr_setpgroupposix_spawnattr_setschedparamposix_spawnattr_setschedpolicyposix_spawnattr_setsigdefaultposix_spawnattr_setsigmaskposix_spawnpposix_trace_attr_destroyposix_trace_attr_getclockresposix_trace_attr_getcreatetimeposix_trace_attr_getgenversionposix_trace_attr_getinheritedposix_trace_attr_getlogfullpolicyposix_trace_attr_getlogsizeposix_trace_attr_getmaxdatasizeposix_trace_attr_getmaxsystemeventsizeposix_trace_attr_getmaxusereventsizeposix_trace_attr_getnameposix_trace_attr_getstreamfullpolicyposix_trace_attr_getstreamsizeposix_trace_attr_initposix_trace_attr_setinheritedposix_trace_attr_setlogfullpolicyposix_trace_attr_setlogsizeposix_trace_attr_setmaxdatasizeposix_trace_attr_setnameposix_trace_attr_setstreamfullpolicyposix_trace_attr_setstreamsizeposix_trace_clearposix_trace_closeposix_trace_createposix_trace_create_withlogposix_trace_eventposix_trace_eventid_equalposix_trace_eventid_get_nameposix_trace_eventid_openposix_trace_eventset_addposix_trace_eventset_delposix_trace_eventset_emptyposix_trace_eventset_fillposix_trace_eventset_ismemberposix_trace_eventtypelist_getnext_idposix_trace_eventtypelist_rewindposix_trace_flushposix_trace_get_attrposix_trace_get_filterposix_trace_get_statusposix_trace_getnext_eventposix_trace_openposix_trace_rewindposix_trace_set_filterposix_trace_shutdownposix_trace_startposix_trace_stopposix_trace_timedgetnext_eventposix_trace_trid_eventid_openposix_trace_trygetnext_eventposix_typed_mem_get_infoposix_typed_mem_openpowpowfpowlpreadprintfpselectpsiginfopsignalpthread_atforkpthread_attr_destroypthread_attr_getdetachstatepthread_attr_getguardsizepthread_attr_getinheritschedpthread_attr_getschedparampthread_attr_getschedpolicypthread_attr_getscopepthread_attr_getstackpthread_attr_getstacksizepthread_attr_initpthread_attr_setdetachstatepthread_attr_setguardsizepthread_attr_setinheritschedpthread_attr_setschedparampthread_attr_setschedpolicypthread_attr_setscopepthread_attr_setstackpthread_attr_setstacksizepthread_barrier_destroypthread_barrier_initpthread_barrier_waitpthread_barrierattr_destroypthread_barrierattr_getpsharedpthread_barrierattr_initpthread_barrierattr_setpsharedpthread_cancelpthread_cleanup_poppthread_cleanup_pushpthread_cond_broadcastpthread_cond_destroypthread_cond_initpthread_cond_signalpthread_cond_timedwaitpthread_cond_waitpthread_condattr_destroypthread_condattr_getclockpthread_condattr_getpsharedpthread_condattr_initpthread_condattr_setclockpthread_condattr_setpsharedpthread_createpthread_detachpthread_equalpthread_exitpthread_getconcurrencypthread_getcpuclockidpthread_getschedparampthread_getspecificpthread_joinpthread_key_createpthread_key_deletepthread_killpthread_mutex_consistentpthread_mutex_destroypthread_mutex_getprioceilingpthread_mutex_initpthread_mutex_lockpthread_mutex_setprioceilingpthread_mutex_timedlockpthread_mutex_trylockpthread_mutex_unlockpthread_mutexattr_destroypthread_mutexattr_getprioceilingpthread_mutexattr_getprotocolpthread_mutexattr_getpsharedpthread_mutexattr_getrobustpthread_mutexattr_gettypepthread_mutexattr_initpthread_mutexattr_setprioceilingpthread_mutexattr_setprotocolpthread_mutexattr_setpsharedpthread_mutexattr_setrobustpthread_mutexattr_settypepthread_oncepthread_rwlock_destroypthread_rwlock_initpthread_rwlock_rdlockpthread_rwlock_timedrdlockpthread_rwlock_timedwrlockpthread_rwlock_tryrdlockpthread_rwlock_trywrlockpthread_rwlock_unlockpthread_rwlock_wrlockpthread_rwlockattr_destroypthread_rwlockattr_getpsharedpthread_rwlockattr_initpthread_rwlockattr_setpsharedpthread_selfpthread_setcancelstatepthread_setcanceltypepthread_setconcurrencypthread_setschedparampthread_setschedpriopthread_setspecificpthread_sigmaskpthread_spin_destroypthread_spin_initpthread_spin_lockpthread_spin_trylockpthread_spin_unlockpthread_testcancelptsnameputcputc_unlockedputcharputchar_unlockedputenvputmsgputpmsgputspututxlineputwcputwcharpwriteqsortquick_exitraiserandrand_rrandomreadreaddirreaddir_rreadlinkreadlinkatreadvreallocrealpathrecvrecvfromrecvmsgregcompregerrorregexecregfreeremainderremainderfremainderlremoveremqueremquoremquofremquolrenamerenameatrewindrewinddirrintrintfrintlrmdirroundroundfroundlscalblnscalblnfscalblnlscalbnscalbnfscalbnlscandirscanfsched_get_priority_maxsched_get_priority_minsched_getparamsched_getschedulersched_rr_get_intervalsched_setparamsched_setschedulersched_yieldseed48seekdirselectsem_closesem_destroysem_getvaluesem_initsem_opensem_postsem_timedwaitsem_trywaitsem_unlinksem_waitsemctlsemgetsemopsendsendmsgsendtosetbufsetegidsetenvseteuidsetgidsetgrentsethostentsetitimersetjmpsetkeysetlocalesetlogmasksetnetentsetpgidsetpgrpsetprioritysetprotoentsetpwentsetregidsetreuidsetrlimitsetserventsetsidsetsockoptsetstatesetuidsetutxentsetvbufshm_openshm_unlinkshmatshmctlshmdtshmgetshutdownsigactionsigaddsetsigaltstacksigdelsetsigemptysetsigfillsetsigholdsigignoresiginterruptsigismembersiglongjmpsignalsignbitsigngamsigpausesigpendingsigprocmasksigqueuesigrelsesigsetsigsetjmpsigsuspendsigtimedwaitsigwaitsigwaitinfosinsinfsinhsinhfsinhlsinlsleepsnprintfsockatmarksocketsocketpairsprintfsqrtsqrtfsqrtlsrandsrand48srandomsscanfstatstatvfsstderrstdinstdoutstpcpystpncpystrcasecmpstrcasecmp_lstrcatstrchrstrcmpstrcollstrcoll_lstrcpystrcspnstrdupstrerrorstrerror_lstrerror_rstrfmonstrfmon_lstrftimestrftime_lstrlenstrncasecmpstrncasecmp_lstrncatstrncmpstrncpystrndupstrnlenstrpbrkstrptimestrrchrstrsignalstrspnstrstrstrtodstrtofstrtoimaxstrtokstrtok_rstrtolstrtoldstrtollstrtoulstrtoullstrtoumaxstrxfrmstrxfrm_lswabswprintfswscanfsymlinksymlinkatsyncsysconfsyslogsystemtantanftanhtanhftanhltanltcdraintcflowtcflushtcgetattrtcgetpgrptcgetsidtcsendbreaktcsetattrtcsetpgrptdeletetelldirtempnamtfindtgammatgammaftgammaltimetimer_createtimer_deletetimer_getoverruntimer_gettimetimer_settimetimestimezonetmpfiletmpnamtoasciitolowertolower_ltouppertoupper_ltowctranstowctrans_ltowlowertowlower_ltowuppertowupper_ltrunctruncatetruncftruncltsearchttynamettyname_rtwalktznametzsetulimitumaskunameungetcungetwcunlinkunlinkatunlockptunsetenvuselocaleutimeutimensatutimesva_argva_copyva_endva_startvdprintfvfprintfvfscanfvfwprintfvfwscanfvprintfvscanfvsnprintfvsprintfvsscanfvswprintfvswscanfvwprintfvwscanfwaitwaitidwaitpidwcpcpywcpncpywcrtombwcscasecmpwcscasecmp_lwcscatwcschrwcscmpwcscollwcscoll_lwcscpywcscspnwcsdupwcsftimewcslenwcsncasecmpwcsncasecmp_lwcsncatwcsncmpwcsncpywcsnlenwcsnrtombswcspbrkwcsrchrwcsrtombswcsspnwcsstrwcstodwcstofwcstoimaxwcstokwcstolwcstoldwcstollwcstombswcstoulwcstoullwcstoumaxwcswidthwcsxfrmwcsxfrm_lwctobwctombwctranswctrans_lwctypewctype_lwcwidthwmemchrwmemcmpwmemcpywmemmovewmemsetwordexpwordfreewprintfwritewritevwscanfy0y1yn
Next: FD_ISSET, Up: ISO C and POSIX Function Substitutes [Contents][Index]
FD_CLRPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/FD_CLR.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: FD_SET, Previous: FD_CLR, Up: ISO C and POSIX Function Substitutes [Contents][Index]
FD_ISSETPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/FD_ISSET.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: FD_ZERO, Previous: FD_ISSET, Up: ISO C and POSIX Function Substitutes [Contents][Index]
FD_SETPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/FD_SET.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: _Exit, Previous: FD_SET, Up: ISO C and POSIX Function Substitutes [Contents][Index]
FD_ZEROPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/FD_ZERO.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: _exit, Previous: FD_ZERO, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_ExitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_Exit.html
Gnulib module: _Exit
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: _longjmp, Previous: _Exit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_exitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_exit.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: _setjmp, Previous: _exit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_longjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_longjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: A future revision of POSIX later than the 2008/2009 one may drop the
functions _setjmp and _longjmp. Still, in 2008, on all
systems which have _setjmp, it is the fastest way to save the
registers but not the signal mask (up to 30 times faster than setjmp
on some systems).
Next: _tolower, Previous: _longjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_setjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_setjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: A future revision of POSIX later than the 2008/2009 one may drop the
functions _setjmp and _longjmp. Still, in 2008, on all
systems which have _setjmp, it is the fastest way to save the
registers but not the signal mask (up to 30 times faster than setjmp
on some systems).
Next: _toupper, Previous: _setjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_tolowerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_tolower.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: a64l, Previous: _tolower, Up: ISO C and POSIX Function Substitutes [Contents][Index]
_toupperPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/_toupper.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: abort, Previous: _toupper, Up: ISO C and POSIX Function Substitutes [Contents][Index]
a64lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/a64l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: abs, Previous: a64l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
abortPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/abort.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: accept, Previous: abort, Up: ISO C and POSIX Function Substitutes [Contents][Index]
absPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/abs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: access, Previous: abs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acceptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/accept.html
Gnulib module: accept
Portability problems fixed by Gnulib:
accept function cannot be used in calls to read,
write, and close; you have to use recv, send,
closesocket in these cases instead.
errno, and WSAGetLastError must be used
instead.
_HPUX_ALT_XOPEN_SOCKET_API
is not defined, this function behaves incorrectly because it is declared
to take a pointer to a 64-bit wide socklen_t entity but in fact
considers it as a pointer to a 32-bit wide unsigned int entity.
Portability problems not fixed by Gnulib:
accept function cannot be used
in calls to read, write, and close; you have to use
recv, send, closesocket in these cases instead.
socklen_t type; in this case this function’s
third argument type is ‘int *’.
Next: acos, Previous: accept, Up: ISO C and POSIX Function Substitutes [Contents][Index]
accessPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/access.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Other problems of this function:
stat versus lstat). If you need this option, use
the Gnulib module faccessat with the AT_EACCESS flag.
Next: acosf, Previous: access, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acosPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acos.html
Gnulib module: acos
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: acosh, Previous: acos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acosfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acosf.html
Gnulib module: acosf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: acoshf, Previous: acosf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acoshPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acosh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: acoshl, Previous: acosh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acoshfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acoshf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: acosl, Previous: acoshf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acoshlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acoshl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: aio_cancel, Previous: acoshl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
acoslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/acosl.html
Gnulib module: acosl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: aio_error, Previous: acosl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_cancelPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_cancel.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aio_fsync, Previous: aio_cancel, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_errorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_error.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aio_read, Previous: aio_error, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_fsyncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_fsync.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aio_return, Previous: aio_fsync, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_readPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_read.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aio_suspend, Previous: aio_read, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_returnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_return.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aio_write, Previous: aio_return, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_suspendPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_suspend.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: alarm, Previous: aio_suspend, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aio_writePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/aio_write.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: aligned_alloc, Previous: aio_write, Up: ISO C and POSIX Function Substitutes [Contents][Index]
alarmPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/alarm.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<io.h> header on some platforms:
mingw (2012 or newer).
Next: alphasort, Previous: alarm, Up: ISO C and POSIX Function Substitutes [Contents][Index]
aligned_allocGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asctime, Previous: aligned_alloc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
alphasortPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/alphasort.html
Gnulib module: alphasort
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
const void * on some platforms:
glibc 2.3.6, Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, Interix 3.5.
void * on some platforms:
AIX 5.1.
Next: asctime_r, Previous: alphasort, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asctimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asctime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asin, Previous: asctime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asctime_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asctime_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: asinf, Previous: asctime_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asin.html
Gnulib module: asin
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asinh, Previous: asin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asinf.html
Gnulib module: asinf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asinhf, Previous: asinf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asinh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asinhl, Previous: asinh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asinhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: asinl, Previous: asinhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asinhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: assert, Previous: asinhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
asinlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/asinl.html
Gnulib module: asinl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atan, Previous: asinl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
assertPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/assert.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Extension: Gnulib offers a module ‘assert’ that allows the installer to disable assertions through a ‘configure’ option: ‘--disable-assert’.
Next: atan2, Previous: assert, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atan.html
Gnulib module: atan
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atan2f, Previous: atan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atan2POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atan2.html
Gnulib module: atan2
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atan2l, Previous: atan2, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atan2fPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atan2f.html
Gnulib module: atan2f
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atanf, Previous: atan2f, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atan2lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atan2l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atanh, Previous: atan2l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atanf.html
Gnulib module: atanf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atanhf, Previous: atanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atanh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atanhl, Previous: atanh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atanhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atanl, Previous: atanhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atanhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atexit, Previous: atanhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atanlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atanl.html
Gnulib module: atanl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atof, Previous: atanl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atexitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atexit.html
Gnulib module: atexit
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atoi, Previous: atexit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atofPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atof.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atol, Previous: atof, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atoiPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atoi.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: atoll, Previous: atoi, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atol.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: basename, Previous: atol, Up: ISO C and POSIX Function Substitutes [Contents][Index]
atollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/atoll.html
Gnulib module: atoll
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: bind, Previous: atoll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
basenamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/basename.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
basename: the POSIX
version and the GNU version.
basename assumes file names in POSIX syntax; it does not work with file
names in Windows syntax.
The Gnulib module dirname provides similar API, with function
base_name, that also works with Windows file names.
Next: bsearch, Previous: basename, Up: ISO C and POSIX Function Substitutes [Contents][Index]
bindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/bind.html
Gnulib module: bind
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: btowc, Previous: bind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
bsearchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/bsearch.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: c16rtomb, Previous: bsearch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
btowcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/btowc.html
Gnulib module: btowc
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
mbrtowc and can return WEOF:
glibc 2.23, MirOS BSD #10.
Next: c32rtomb, Previous: btowc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
c16rtombGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cabs, Previous: c16rtomb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
c32rtombGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cabsf, Previous: c32rtomb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cabsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cabs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cabsl, Previous: cabs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cabsfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cabsf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacos, Previous: cabsf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cabslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cabsl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacosf, Previous: cabsl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacosPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacos.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacosh, Previous: cacos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacosfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacosf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacoshf, Previous: cacosf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacoshPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacosh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacoshl, Previous: cacosh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacoshfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacoshf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cacosl, Previous: cacoshf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacoshlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacoshl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: calloc, Previous: cacoshl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cacoslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cacosl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: carg, Previous: cacosl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
callocPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/calloc.html
Gnulib module: calloc-posix
Portability problems fixed by Gnulib:
errno to ENOMEM on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Extension: Gnulib provides a module ‘calloc-gnu’ that substitutes a
calloc implementation that behaves more like the glibc implementation.
Next: cargf, Previous: calloc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cargPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/carg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cargl, Previous: carg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cargfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cargf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casin, Previous: cargf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
carglPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cargl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casinf, Previous: cargl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casin.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casinh, Previous: casin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casinf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casinhf, Previous: casinf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casinh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casinhl, Previous: casinh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casinhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: casinl, Previous: casinhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casinhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catan, Previous: casinhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
casinlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/casinl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catanf, Previous: casinl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catan.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catanh, Previous: catan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catanhf, Previous: catanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catanh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catanhl, Previous: catanh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catanhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catanl, Previous: catanhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catanhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catclose, Previous: catanhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catanlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catanl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catgets, Previous: catanl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catclosePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catclose.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: catopen, Previous: catclose, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catgetsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catgets.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cbrt, Previous: catgets, Up: ISO C and POSIX Function Substitutes [Contents][Index]
catopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/catopen.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cbrtf, Previous: catopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cbrtPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cbrt.html
Gnulib module: cbrt
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cbrtl, Previous: cbrt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cbrtfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cbrtf.html
Gnulib module: cbrtf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ccos, Previous: cbrtf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cbrtlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cbrtl.html
Gnulib module: cbrtl or cbrtl-ieee
Portability problems fixed by either Gnulib module cbrtl or cbrtl-ieee
Portability problems fixed by Gnulib module cbrtl-ieee:
Portability problems not fixed by Gnulib:
Next: ccosf, Previous: cbrtl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccosPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccos.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ccosh, Previous: ccos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccosfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccosf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ccoshf, Previous: ccosf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccoshPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccosh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ccoshl, Previous: ccosh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccoshfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccoshf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ccosl, Previous: ccoshf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccoshlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccoshl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ceil, Previous: ccoshl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ccoslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ccosl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ceilf, Previous: ccosl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ceilPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ceil.html
Gnulib module: ceil or ceil-ieee
Portability problems fixed by either Gnulib module ceil or ceil-ieee:
Portability problems fixed by Gnulib module ceil-ieee:
Portability problems not fixed by Gnulib:
Next: ceill, Previous: ceil, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ceilfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ceilf.html
Gnulib module: ceilf or ceilf-ieee
Portability problems fixed by either Gnulib module ceilf or ceilf-ieee:
Portability problems fixed by Gnulib module ceilf-ieee:
Portability problems not fixed by Gnulib:
Next: cexp, Previous: ceilf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ceillPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ceill.html
Gnulib module: ceill or ceill-ieee
Portability problems fixed by either Gnulib module ceill or ceill-ieee:
Portability problems fixed by Gnulib module ceill-ieee:
Portability problems not fixed by Gnulib:
Next: cexpf, Previous: ceill, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cexpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cexp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cexpl, Previous: cexp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cexpfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cexpf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cfgetispeed, Previous: cexpf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cexplPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cexpl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cfgetospeed, Previous: cexpl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cfgetispeedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cfgetispeed.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cfsetispeed, Previous: cfgetispeed, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cfgetospeedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cfgetospeed.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cfsetospeed, Previous: cfgetospeed, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cfsetispeedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cfsetispeed.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: chdir, Previous: cfsetispeed, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cfsetospeedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cfsetospeed.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: chmod, Previous: cfsetospeed, Up: ISO C and POSIX Function Substitutes [Contents][Index]
chdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/chdir.html
Gnulib module: —
Portability problems fixed by Gnulib:
<io.h> or
<direct.h>) on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: chown, Previous: chdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
chmodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/chmod.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cimag, Previous: chmod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
chownPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/chown.html
Gnulib module: chown
Portability problems fixed by Gnulib:
chown("link-to-file/",uid,gid):
FreeBSD 7.2, AIX 7.1, Solaris 9.
lchown.
ENOSYS:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: cimagf, Previous: chown, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cimagPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cimag.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cimagl, Previous: cimag, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cimagfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cimagf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clearerr, Previous: cimagf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cimaglPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cimagl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock, Previous: cimagl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clearerrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clearerr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock_getcpuclockid, Previous: clearerr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock_getres, Previous: clock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clock_getcpuclockidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock_getcpuclockid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock_gettime, Previous: clock_getcpuclockid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clock_getresPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock_getres.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock_nanosleep, Previous: clock_getres, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clock_gettimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock_gettime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clock_settime, Previous: clock_gettime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clock_nanosleepPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock_nanosleep.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clog, Previous: clock_nanosleep, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clock_settimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clock_settime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clogf, Previous: clock_settime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clogPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clog.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clogl, Previous: clog, Up: ISO C and POSIX Function Substitutes [Contents][Index]
clogfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clogf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: close, Previous: clogf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cloglPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/clogl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: closedir, Previous: clogl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/close.html
Gnulib module: close
Portability problems fixed by Gnulib:
socket and accept
do not return file descriptors that can be closed by close.
Instead, closesocket must be used.
Portability problems not fixed by Gnulib:
socket and accept do not return file descriptors
that can be closed by close. Instead, closesocket must be
used.
Next: closelog, Previous: close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
closedirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/closedir.html
Gnulib module: closedir
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: confstr, Previous: closedir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
closelogPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/closelog.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: conj, Previous: closelog, Up: ISO C and POSIX Function Substitutes [Contents][Index]
confstrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/confstr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: conjf, Previous: confstr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
conjPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/conj.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: conjl, Previous: conj, Up: ISO C and POSIX Function Substitutes [Contents][Index]
conjfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/conjf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: connect, Previous: conjf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
conjlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/conjl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: copysign, Previous: conjl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
connectPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/connect.html
Gnulib module: connect
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: copysignf, Previous: connect, Up: ISO C and POSIX Function Substitutes [Contents][Index]
copysignPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/copysign.html
Gnulib module: copysign
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: copysignl, Previous: copysign, Up: ISO C and POSIX Function Substitutes [Contents][Index]
copysignfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/copysignf.html
Gnulib module: copysignf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cos, Previous: copysignf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
copysignlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/copysignl.html
Gnulib module: copysignl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cosf, Previous: copysignl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cosPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cos.html
Gnulib module: cos
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cosh, Previous: cos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cosfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cosf.html
Gnulib module: cosf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: coshf, Previous: cosf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
coshPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cosh.html
Gnulib module: cosh
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: coshl, Previous: cosh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
coshfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/coshf.html
Gnulib module: coshf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cosl, Previous: coshf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
coshlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/coshl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cpow, Previous: coshl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
coslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cosl.html
Gnulib module: cosl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cpowf, Previous: cosl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cpowPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cpow.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cpowl, Previous: cpow, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cpowfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cpowf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cproj, Previous: cpowf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cpowlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cpowl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cprojf, Previous: cpowl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cprojPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cproj.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: cprojl, Previous: cproj, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cprojfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cprojf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: creal, Previous: cprojf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cprojlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/cprojl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: crealf, Previous: cprojl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
crealPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/creal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: creall, Previous: creal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
crealfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/crealf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: creat, Previous: crealf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
creallPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/creall.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: crypt, Previous: creall, Up: ISO C and POSIX Function Substitutes [Contents][Index]
creatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/creat.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
O_TEXT mode. If you
need a file handle in O_BINARY mode, you need to use the function
open instead.
off_t is a 32-bit type, creat may not work
correctly to create files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: csin, Previous: creat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
cryptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/crypt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<unistd.h>
(without -D_GNU_SOURCE) on some platforms:
glibc (at least 2.11–2.13).
Next: csinf, Previous: crypt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csin.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csinh, Previous: csin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csinf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csinhf, Previous: csinf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csinh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csinhl, Previous: csinh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csinhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csinl, Previous: csinhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csinhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csqrt, Previous: csinhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csinlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csinl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csqrtf, Previous: csinl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csqrtPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csqrt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: csqrtl, Previous: csqrt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csqrtfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csqrtf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctan, Previous: csqrtf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
csqrtlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/csqrtl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctanf, Previous: csqrtl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctan.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctanh, Previous: ctan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctanhf, Previous: ctanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctanh.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctanhl, Previous: ctanh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctanhf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctanl, Previous: ctanhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctanhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctermid, Previous: ctanhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctanlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctanl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctime, Previous: ctanl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctermidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctermid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ctime_r, Previous: ctermid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctime.html
Gnulib module: ctime
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
Portability problems not fixed by Gnulib:
ctime function need not be reentrant, and consequently is
not required to be thread safe. Implementations of ctime
typically write the timestamp into static buffer. If two threads
call ctime at roughly the same time, you might end up with the
wrong date in one of the threads, or some undefined string. There is
a re-entrant interface ctime_r.
tzset.
A more flexible function is strftime. However, note that it is
locale dependent.
Next: daylight, Previous: ctime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ctime_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ctime_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
ctime_r takes a pre-allocated buffer and length of the buffer,
and returns NULL on errors.
The input buffer should be at least 26 bytes in size. The output
string is locale-independent. However, years can have more than 4
digits if time_t is sufficiently wide, so the length of the
required output buffer is not easy to determine. Increasing the
buffer size when ctime_r returns NULL is not necessarily
sufficient. The NULL return value could mean some other error
condition, which will not go away by increasing the buffer size.
A more flexible function is strftime. However, note that it is
locale dependent.
Next: dbm_clearerr, Previous: ctime_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
daylightPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/daylight.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tzset.
A more portable way of getting the UTC offset is to use
strftime with the %z format. See strftime.
Next: dbm_close, Previous: daylight, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_clearerrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_clearerr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_delete, Previous: dbm_clearerr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_close.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_error, Previous: dbm_close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_deletePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_delete.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_fetch, Previous: dbm_delete, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_errorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_error.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_firstkey, Previous: dbm_error, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_fetchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_fetch.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_nextkey, Previous: dbm_fetch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_firstkeyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_firstkey.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_open, Previous: dbm_firstkey, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_nextkeyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_nextkey.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dbm_store, Previous: dbm_nextkey, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: difftime, Previous: dbm_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dbm_storePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dbm_store.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dirfd, Previous: dbm_store, Up: ISO C and POSIX Function Substitutes [Contents][Index]
difftimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/difftime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dirname, Previous: difftime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dirfdPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dirfd.html
Gnulib module: dirfd
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
With the dirfd module, this functions always sets errno when it
fails. (POSIX does not require that dirfd sets errno when it
fails.)
Next: div, Previous: dirfd, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dirnamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dirname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
dirname assumes file names in POSIX syntax; it does not work with file
names in Windows syntax.
The Gnulib module dirname provides similar API, with functions
dir_name and mdir_name, that also works with Windows
file names.
Next: dlclose, Previous: dirname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
divPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/div.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlerror, Previous: div, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dlclosePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dlclose.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlopen, Previous: dlclose, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dlerrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dlerror.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlsym, Previous: dlerror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dlopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dlopen.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dprintf, Previous: dlopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dlsymPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dlsym.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: drand48, Previous: dlsym, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dprintf.html
Gnulib module: dprintf or dprintf-posix
Portability problems fixed by either Gnulib module dprintf or dprintf-posix:
Portability problems fixed by Gnulib module dprintf-posix:
Portability problems not fixed by Gnulib:
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: dup, Previous: dprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
drand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/drand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dup2, Previous: drand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dup.html
Gnulib module: dup
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: duplocale, Previous: dup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
dup2POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/dup2.html
Gnulib module: dup2 or dup2-obsolete
Portability problems fixed by either Gnulib module dup2 or dup2-obsolete:
EINVAL when duplicating an fd to itself:
Android.
FD_CLOEXEC flag when duplicating an fd
to itself on some platforms:
Haiku.
dup2 (1, 1) on some platforms:
Cygwin 1.5.x.
-EBADF instead of -1 on some platforms:
Linux releases between July 2008 and May 2009 (versions 2.6.27 to 2.6.29).
EMFILE instead of EBADF for
large targets, which interferes with using
dup2(fd,fd)==fd) as the minimal EBADF filter:
AIX 7.1, FreeBSD 6.1, Cygwin 1.5.
Portability problems fixed by Gnulib module dup2-obsolete:
Portability problems not fixed by Gnulib:
Next: encrypt, Previous: dup2, Up: ISO C and POSIX Function Substitutes [Contents][Index]
duplocalePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/duplocale.html
Gnulib module: duplocale
Portability problems fixed by Gnulib:
LC_GLOBAL_LOCALE is not supported on some platforms:
glibc 2.11, AIX 7.1.
LC_GLOBAL_LOCALE, this function returns a wrong result
on some platforms:
NetBSD 7.0.
Portability problems not fixed by Gnulib:
Next: endgrent, Previous: duplocale, Up: ISO C and POSIX Function Substitutes [Contents][Index]
encryptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/encrypt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<unistd.h>
(without -D_GNU_SOURCE) on some platforms:
glibc (at least 2.11–2.13).
Next: endhostent, Previous: encrypt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endgrentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endgrent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endnetent, Previous: endgrent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endhostentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endhostent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endprotoent, Previous: endhostent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endnetentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endnetent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endpwent, Previous: endnetent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endprotoentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endprotoent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endservent, Previous: endprotoent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endpwentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endpwent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endutxent, Previous: endpwent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endserventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endservent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: environ, Previous: endservent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
endutxentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/endutxent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erand48, Previous: endutxent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
environPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/environ.html
Gnulib module: environ
Portability problems fixed by Gnulib:
extern char **environ;
to get the variable declared. This does not work any more, however, in shared libraries on Mac OS X 10.5. Here is a workaround: Instead, one can use
#include <crt_externs.h> #define environ (*_NSGetEnviron())
This works at all versions of Mac OS X.
-Wl,--disable-auto-import is in use.
Portability problems not fixed by Gnulib:
Next: erf, Previous: environ, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erfc, Previous: erand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erf.html
Gnulib module: erf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erfcf, Previous: erf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erfcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erfc.html
Gnulib module: erfc
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erfcl, Previous: erfc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erfcfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erfcf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erff, Previous: erfcf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erfclPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erfcl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erfl, Previous: erfcl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erffPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erff.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: errno, Previous: erff, Up: ISO C and POSIX Function Substitutes [Contents][Index]
erflPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/erfl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execl, Previous: erfl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
errnoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/errno.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno; their error code is
available through WSAGetLastError() instead.
Next: execle, Previous: errno, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execlp, Previous: execl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execlePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execle.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execv, Previous: execle, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execlpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execlp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execve, Previous: execlp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execvp, Previous: execv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execvePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execve.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exit, Previous: execve, Up: ISO C and POSIX Function Substitutes [Contents][Index]
execvpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/execvp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp, Previous: execvp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
exitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/exit.html
Gnulib module: stdlib
Portability problems fixed by Gnulib:
EXIT_SUCCESS and EXIT_FAILURE,
see stdlib.h.
Portability problems not fixed by Gnulib:
Next: exp2, Previous: exit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
expPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/exp.html
Gnulib module: exp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp2f, Previous: exp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
exp2POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/exp2.html
Gnulib module: exp2
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp2l, Previous: exp2, Up: ISO C and POSIX Function Substitutes [Contents][Index]
exp2fPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/exp2f.html
Gnulib module: exp2f
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: expf, Previous: exp2f, Up: ISO C and POSIX Function Substitutes [Contents][Index]
exp2lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/exp2l.html
Gnulib module: exp2l or exp2l-ieee
Portability problems fixed by either Gnulib module exp2l or exp2l-ieee:
Portability problems fixed by Gnulib module exp2l-ieee:
Portability problems not fixed by Gnulib:
Next: expl, Previous: exp2l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
expfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/expf.html
Gnulib module: expf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: expm1, Previous: expf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
explPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/expl.html
Gnulib module: expl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: expm1f, Previous: expl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
expm1POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/expm1.html
Gnulib module: expm1 or expm1-ieee
Portability problems fixed by either Gnulib module expm1 or expm1-ieee:
Portability problems fixed by Gnulib module expm1-ieee:
Portability problems not fixed by Gnulib:
Next: expm1l, Previous: expm1, Up: ISO C and POSIX Function Substitutes [Contents][Index]
expm1fPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/expm1f.html
Gnulib module: expm1f
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fabs, Previous: expm1f, Up: ISO C and POSIX Function Substitutes [Contents][Index]
expm1lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/expm1l.html
Gnulib module: expm1l
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fabsf, Previous: expm1l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fabsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fabs.html
Gnulib module: fabs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fabsl, Previous: fabs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fabsfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fabsf.html
Gnulib module: fabsf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: faccessat, Previous: fabsf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fabslPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fabsl.html
Gnulib module: fabsl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fattach, Previous: fabsl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
faccessatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/faccessat.html
Gnulib module: faccessat
Portability problems fixed by Gnulib:
faccessat (dfd, "file/", amode, flag)
succeeds instead of failing when file is not a directory.
macOS 10.13.
Portability problems not fixed by Gnulib:
AT_SYMLINK_NOFOLLOW flag,
which is supported by GNU faccessat.
Other problems of this function:
Next: fchdir, Previous: faccessat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fattachPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fattach.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fchmod, Previous: fattach, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fchdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fchdir.html
Gnulib module: fchdir
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fchmodat, Previous: fchdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fchmodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fchmod.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fchown, Previous: fchmod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fchmodatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fchmodat.html
Gnulib module: fchmodat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
fchmodat(…,AT_SYMLINK_NOFOLLOW)
may fail with EOPNOTSUPP when called on a symlink, but some
platforms, as well as the gnulib replacement, fail for any use of
AT_SYMLINK_NOFOLLOW even if the target was not a symlink:
glibc, Cygwin.
Next: fchownat, Previous: fchmodat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fchownPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fchown.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fclose, Previous: fchown, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fchownatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fchownat.html
Gnulib module: fchownat
Portability problems fixed by Gnulib:
fchown(dir,"link-to-file/",uid,gid,flag):
Solaris 9.
AT_SYMLINK_NOFOLLOW:
Linux kernel 2.6.17.
lchown is unsupported, or fail altogether if
chown is unsupported.
Portability problems not fixed by Gnulib:
Next: fcntl, Previous: fchownat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fclosePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fclose.html
Gnulib module: fclose
Portability problems fixed by Gnulib:
socket and accept
followed by fdopen do not return streams that can be closed by
fclose.
Portability problems not fixed by Gnulib:
errno
upon failure.
Next: fdatasync, Previous: fclose, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fcntlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fcntl.html
Gnulib module: fcntl
Portability problems fixed by Gnulib:
F_DUPFD_CLOEXEC on some
platforms:
glibc with Linux kernels before 2.6.24,
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, AIX 7.1, HP-UX 11,
IRIX 6.5, OSF/1 5.1, Solaris 11 2010-11, Cygwin 1.7.1, Interix 3.5,
BeOS.
Note that the gnulib replacement code is functional but not atomic.
F_DUPFD action of this function does not reject
out-of-range targets properly on some platforms:
AIX 7.1, Cygwin 1.5.x, Haiku.
F_DUPFD action of this function mistakenly clears
FD_CLOEXEC on the source descriptor on some platforms:
Haiku.
Portability problems not fixed by Gnulib:
F_SETFD,
F_GETFL, F_SETFL, F_GETOWN, F_SETOWN,
F_GETLK, F_SETLK, and F_SETLKW on some platforms:
mingw, MSVC 14.
Next: fdetach, Previous: fcntl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdatasyncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdatasync.html
Gnulib module: fdatasync
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fdim, Previous: fdatasync, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdetachPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdetach.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fdimf, Previous: fdetach, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdimPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdim.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fdiml, Previous: fdim, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdimfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdimf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fdopen, Previous: fdimf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdimlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdiml.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fdopendir, Previous: fdiml, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdopen.html
Gnulib module: fdopen
Portability problems fixed by Gnulib:
errno
upon failure.
Portability problems not fixed by Gnulib:
Next: feclearexcept, Previous: fdopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fdopendirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fdopendir.html
Gnulib module: fdopendir
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fegetenv, Previous: fdopendir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
feclearexceptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/feclearexcept.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fegetexceptflag, Previous: feclearexcept, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fegetenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fegetenv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fegetround, Previous: fegetenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fegetexceptflagPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fegetexceptflag.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: feholdexcept, Previous: fegetexceptflag, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fegetroundPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fegetround.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: feof, Previous: fegetround, Up: ISO C and POSIX Function Substitutes [Contents][Index]
feholdexceptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/feholdexcept.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: feraiseexcept, Previous: feholdexcept, Up: ISO C and POSIX Function Substitutes [Contents][Index]
feofPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/feof.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ferror, Previous: feof, Up: ISO C and POSIX Function Substitutes [Contents][Index]
feraiseexceptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/feraiseexcept.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fesetenv, Previous: feraiseexcept, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ferrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ferror.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fesetexceptflag, Previous: ferror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fesetenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fesetenv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fesetround, Previous: fesetenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fesetexceptflagPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fesetexceptflag.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fetestexcept, Previous: fesetexceptflag, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fesetroundPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fesetround.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: feupdateenv, Previous: fesetround, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fetestexceptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fetestexcept.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fexecve, Previous: fetestexcept, Up: ISO C and POSIX Function Substitutes [Contents][Index]
feupdateenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/feupdateenv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fflush, Previous: feupdateenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fexecvePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fexecve.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ffs, Previous: fexecve, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fflushPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fflush.html
Gnulib module: fflush
Portability problems fixed by Gnulib:
fflush followed by fseek or fseeko, applied to an input
stream, should have the effect of positioning the underlying file descriptor.
It doesn’t do this on some platforms.
fflush on an input stream changes the position of the stream to the
end of the previous buffer, on some platforms: mingw, MSVC 14.
fflush on an input stream right after ungetc does not discard
the ungetc buffer, on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, Cygwin 1.5.25-10.
Portability problems not fixed by Gnulib:
fflush, ftell, ftello, fgetpos behave incorrectly
on input streams that are opened in O_TEXT mode and whose contents
contains Unix line terminators (LF), on some platforms: mingw, MSVC 14.
errno
upon failure.
MSVC_INVALID_PARAMETER_HANDLING is
HAIRY_LIBRARY_HANDLING or SANE_LIBRARY_HANDLING,
on some platforms:
MSVC 14.
fflush on an input stream right after ungetc does not discard
the ungetc buffer, on some platforms:
AIX 5.1, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 11 2010-11, mingw, MSVC 14.
Next: fgetc, Previous: fflush, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ffsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ffs.html
Gnulib module: ffs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fgetpos, Previous: ffs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fgetcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fgetc.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
MSVC_INVALID_PARAMETER_HANDLING is
HAIRY_LIBRARY_HANDLING or SANE_LIBRARY_HANDLING,
on some platforms:
MSVC 14.
Next: fgets, Previous: fgetc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fgetposPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fgetpos.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
fflush, ftell, ftello, fgetpos behave incorrectly
on input streams that are opened in O_TEXT mode and whose contents
contains Unix line terminators (LF), on some platforms: mingw, MSVC 14.
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
off_t is a 64-bit type, but fseeko is
not present, stream operations on files larger than 2 GB silently do
the wrong thing. This affects BSD/OS, which is mostly obsolete.
Next: fgetwc, Previous: fgetpos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fgetsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fgets.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
Next: fgetws, Previous: fgets, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fgetwcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fgetwc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: fileno, Previous: fgetwc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fgetwsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fgetws.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: flockfile, Previous: fgetws, Up: ISO C and POSIX Function Substitutes [Contents][Index]
filenoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fileno.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: floor, Previous: fileno, Up: ISO C and POSIX Function Substitutes [Contents][Index]
flockfilePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/flockfile.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: floorf, Previous: flockfile, Up: ISO C and POSIX Function Substitutes [Contents][Index]
floorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/floor.html
Gnulib module: floor or floor-ieee
Portability problems fixed by either Gnulib module floor or floor-ieee:
Portability problems fixed by Gnulib module floor-ieee:
Portability problems not fixed by Gnulib:
Next: floorl, Previous: floor, Up: ISO C and POSIX Function Substitutes [Contents][Index]
floorfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/floorf.html
Gnulib module: floorf or floorf-ieee
Portability problems fixed by either Gnulib module floorf or floorf-ieee:
Portability problems fixed by Gnulib module floorf-ieee:
Portability problems not fixed by Gnulib:
Next: fma, Previous: floorf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
floorlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/floorl.html
Gnulib module: floorl or floorl-ieee
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmaf, Previous: floorl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fma.html
Gnulib module: fma
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmal, Previous: fma, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmafPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmaf.html
Gnulib module: fmaf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmax, Previous: fmaf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmal.html
Gnulib module: fmal
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmaxf, Previous: fmal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmaxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmax.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmaxl, Previous: fmax, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmaxfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmaxf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmemopen, Previous: fmaxf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmaxlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmaxl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmin, Previous: fmaxl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmemopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmemopen.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fminf, Previous: fmemopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fminPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmin.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fminl, Previous: fmin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fminfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fminf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmod, Previous: fminf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fminlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fminl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fmodf, Previous: fminl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmod.html
Gnulib module: fmod or fmod-ieee
Portability problems fixed by either Gnulib module fmod or fmod-ieee:
Portability problems fixed by Gnulib module fmod-ieee:
Portability problems not fixed by Gnulib:
Next: fmodl, Previous: fmod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmodfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmodf.html
Gnulib module: fmodf or fmodf-ieee
Portability problems fixed by either Gnulib module fmodf or fmodf-ieee:
Portability problems fixed by Gnulib module fmodf-ieee:
Portability problems not fixed by Gnulib:
Next: fmtmsg, Previous: fmodf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmodlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmodl.html
Gnulib module: fmodl or fmodl-ieee
Portability problems fixed by either Gnulib module fmodl or fmodl-ieee:
Portability problems fixed by Gnulib module fmodl-ieee:
Portability problems not fixed by Gnulib:
Next: fnmatch, Previous: fmodl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fmtmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fmtmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fopen, Previous: fmtmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fnmatchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fnmatch.html
Gnulib module: fnmatch or fnmatch-gnu
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fork, Previous: fnmatch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fopen.html
Gnulib module: fopen
Portability problems fixed by Gnulib:
off_t is a 32-bit type, fopen may not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
errno
upon failure.
'\n' to CR/LF by default. Use the
"b" flag if you need reliable binary I/O.
fstat after open and
fdopen, rather than fopen and fileno.
Next: fpathconf, Previous: fopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
forkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fork.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
fork followed by a call of the exec family
(execl, execlp, execle, execv, execvp,
or execve) is less efficient than vfork followed by the same
call. vfork is a variant of fork that has been introduced to
optimize the fork/exec pattern.
spawnvp instead.
Next: fpclassify, Previous: fork, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fpathconfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fpathconf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fprintf, Previous: fpathconf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fpclassifyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fpclassify.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fputc, Previous: fpclassify, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fprintf.html
Gnulib module: fprintf-posix or stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module fprintf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or fprintf-posix, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or fprintf-posix, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EOF but
does not set the error flag for ferror on some platforms:
glibc 2.13, cygwin 1.7.9.
Next: fputs, Previous: fprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fputcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fputc.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
MSVC_INVALID_PARAMETER_HANDLING is
HAIRY_LIBRARY_HANDLING or SANE_LIBRARY_HANDLING,
on some platforms:
MSVC 14.
Next: fputwc, Previous: fputc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fputsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fputs.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: fputws, Previous: fputs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fputwcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fputwc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: fread, Previous: fputwc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fputwsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fputws.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: free, Previous: fputws, Up: ISO C and POSIX Function Substitutes [Contents][Index]
freadPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fread.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
MSVC_INVALID_PARAMETER_HANDLING is
HAIRY_LIBRARY_HANDLING or SANE_LIBRARY_HANDLING,
on some platforms:
MSVC 14.
Next: freeaddrinfo, Previous: fread, Up: ISO C and POSIX Function Substitutes [Contents][Index]
freePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/free.html
Gnulib module: free
Portability problems fixed by Gnulib:
free (NULL) fails.
However, since all such systems are so old as to no longer
be considered “reasonable portability targets,”
this module is no longer useful.
Portability problems not fixed by Gnulib:
Next: freelocale, Previous: free, Up: ISO C and POSIX Function Substitutes [Contents][Index]
freeaddrinfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/freeaddrinfo.html
Gnulib module: getaddrinfo
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: freopen, Previous: freeaddrinfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
freelocalePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/freelocale.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: frexp, Previous: freelocale, Up: ISO C and POSIX Function Substitutes [Contents][Index]
freopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/freopen.html
Gnulib module: freopen
Portability problems fixed by Gnulib:
stream does not already have an open
file descriptor, freopen returns the stream without opening
the file: glibc 2.24.
off_t is a 32-bit type, freopen may not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
errno
upon failure.
NULL file name argument on some
platforms:
OpenBSD 4.9, AIX 7.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 10, mingw, MSVC 14.
fileno(f) will be the same
before and after a call to freopen(name,mode,f). However, the
module freopen-safer can at least protect stdin, stdout,
and stderr.
Next: frexpf, Previous: freopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
frexpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/frexp.html
Gnulib module: frexp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: frexpl, Previous: frexp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
frexpfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/frexpf.html
Gnulib module: frexpf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fscanf, Previous: frexpf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
frexplPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/frexpl.html
Gnulib module: frexpl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fseek, Previous: frexpl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fscanf.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: fseeko, Previous: fscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fseekPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fseek.html
Gnulib module: fseek
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
long is a 32-bit type, fseek does not work
correctly with files larger than 2 GB, even when the AC_SYS_LARGEFILE
macro is used. The fix is to use fseeko instead.
Next: fsetpos, Previous: fseek, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fseekoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fseeko.html
Gnulib module: fseeko
Portability problems fixed by Gnulib:
fseeko in <stdio.h> is not enabled by default
on some platforms:
glibc 2.3.6, OSF/1 5.1.
off_t is a 32-bit type, fseeko does not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
off_t is a 64-bit type, but fseeko is
not present, stream operations on files larger than 2 GB silently do
the wrong thing. This affects BSD/OS, which is mostly obsolete.
Next: fstat, Previous: fseeko, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fsetposPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fsetpos.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: fstatat, Previous: fsetpos, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fstatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fstat.html
Gnulib module: fstat
Portability problems fixed by Gnulib:
off_t is a 32-bit type, fstat may not correctly
report the size of files or block devices larger than 2 GB.
(Cf. AC_SYS_LARGEFILE.)
tv_sec value, tv_nsec might be in the range
-1000000000..-1, representing a negative nanoseconds
offset from tv_sec.
st_atime, st_ctime, st_mtime fields are affected by
the current time zone and by the DST flag of the current time zone on some
platforms:
mingw, MSVC 14 (when the environment variable TZ is set).
Portability problems not fixed by Gnulib:
struct stat.
fstat applied to the file descriptors 0 and 1, returns
different st_ino values, even if standard input and standard output
are not redirected and refer to the same terminal.
Next: fstatvfs, Previous: fstat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fstatatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fstatat.html
Gnulib module: fstatat
Portability problems fixed by Gnulib:
off_t is a 32-bit type, fstatat may
not correctly report the size of files or block devices larger than 2
GB. (Cf. AC_SYS_LARGEFILE.)
fstatat(fd,"file/",buf,flag) succeeds instead of
failing with ENOTDIR.
Solaris 9.
tv_sec value, tv_nsec might be in the range
-1000000000..-1, representing a negative nanoseconds
offset from tv_sec.
Portability problems not fixed by Gnulib:
struct stat.
Next: fsync, Previous: fstatat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fstatvfsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fstatvfs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
f_blocks in ‘struct statvfs’ is a 32-bit
value, this function may not work correctly on files systems larger than
4 TiB. The fix is to use the AC_SYS_LARGEFILE macro. This affects
glibc/Hurd, HP-UX 11, Solaris.
Next: ftell, Previous: fstatvfs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fsyncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fsync.html
Gnulib module: fsync
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
EBADF on some platforms:
AIX 7.1.
Next: ftello, Previous: fsync, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftellPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftell.html
Gnulib module: ftell
Portability problems fixed by Gnulib:
putc that followed a
getc call that reached EOF on some platforms:
Solaris 11 2010-11.
Portability problems not fixed by Gnulib:
fseek on some
platforms:
HP-UX 11.
fflush, ftell, ftello, fgetpos behave incorrectly
on input streams that are opened in O_TEXT mode and whose contents
contains Unix line terminators (LF), on some platforms: mingw, MSVC 14.
long is a 32-bit type, ftell does not work
correctly with files larger than 2 GB, even when the AC_SYS_LARGEFILE
macro is used. The fix is to use ftello instead.
Next: ftok, Previous: ftell, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftelloPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftello.html
Gnulib module: ftello
Portability problems fixed by Gnulib:
ftello in <stdio.h> is not enabled by default
on some platforms:
glibc 2.3.6, OSF/1 5.1.
putc that followed a
getc call that reached EOF on some platforms:
Solaris 11 2010-11.
off_t is a 32-bit type, ftello does not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
fseek on some
platforms:
HP-UX 11.
fflush, ftell, ftello, fgetpos behave incorrectly
on input streams that are opened in O_TEXT mode and whose contents
contains Unix line terminators (LF), on some platforms: mingw, MSVC 14.
off_t is a 64-bit type, but fseeko is
not present, stream operations on files larger than 2 GB silently do
the wrong thing. This affects BSD/OS, which is mostly obsolete.
Next: ftruncate, Previous: ftello, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftokPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftok.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ftrylockfile, Previous: ftok, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftruncatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftruncate.html
Gnulib module: ftruncate
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function is not
applicable to arbitrary lengths for files larger than 2 GB. The fix is to
use the AC_SYS_LARGEFILE macro.
Portability problems not fixed by Gnulib:
Next: ftw, Previous: ftruncate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftrylockfilePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftrylockfile.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: funlockfile, Previous: ftrylockfile, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ftwPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ftw.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
correctly report the size of files or block devices larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: futimens, Previous: ftw, Up: ISO C and POSIX Function Substitutes [Contents][Index]
funlockfilePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/funlockfile.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fwide, Previous: funlockfile, Up: ISO C and POSIX Function Substitutes [Contents][Index]
futimensPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/futimens.html
Gnulib module: futimens
Portability problems fixed by Gnulib:
ENOSYS on some platforms:
Linux kernel 2.6.21.
UTIME_OMIT or UTIME_NOW, some systems require
the tv_sec argument to be 0, and don’t necessarily handle all
file permissions in the manner required by POSIX:
Linux kernel 2.6.25.
UTIME_OMIT for the modification time, but specifying
an access time, some systems fail to update the change time:
Linux kernel 2.6.32, Solaris 11.1.
AT_FDCWD as the fd argument does not properly fail with
EBADF on some systems:
glibc 2.11, Solaris 11.
Portability problems not fixed by Gnulib:
ENOSYS; the gnulib
module ‘utimens’ provides a more reliable interface fdutimens.
stat modifies the access time of
directories on some platforms, so utimensat can only
effectively change directory modification time:
Cygwin 1.5.x.
Next: fwprintf, Previous: futimens, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fwidePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fwide.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
fwide is not guaranteed to be able to change a file stream’s mode
to a different mode than the current one.
Next: fwrite, Previous: fwide, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fwprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fwprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: fwscanf, Previous: fwprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fwritePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fwrite.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
MSVC_INVALID_PARAMETER_HANDLING is
HAIRY_LIBRARY_HANDLING or SANE_LIBRARY_HANDLING,
on some platforms:
MSVC 14.
Next: gai_strerror, Previous: fwrite, Up: ISO C and POSIX Function Substitutes [Contents][Index]
fwscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/fwscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: getaddrinfo, Previous: fwscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gai_strerrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gai_strerror.html
Gnulib module: getaddrinfo
Portability problems fixed by Gnulib:
<ws2tcpip.h> on some
platforms:
mingw, MSVC 14.
char * instead of const char *
on some platforms:
AIX 7.1, HP-UX 11, OSF/1 5.1, Solaris 9, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: getc, Previous: gai_strerror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getaddrinfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getaddrinfo.html
Gnulib module: getaddrinfo
Portability problems fixed by Gnulib:
<ws2tcpip.h> rather than in
<netdb.h>.
Portability problems not fixed by Gnulib:
Next: getc_unlocked, Previous: getaddrinfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getc.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
Next: getchar, Previous: getc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getc_unlockedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getc_unlocked.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getchar_unlocked, Previous: getc_unlocked, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getcharPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getchar.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
Next: getcwd, Previous: getchar, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getchar_unlockedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getchar_unlocked.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getdate, Previous: getchar_unlocked, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getcwdPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getcwd.html
Gnulib module: getcwd or getcwd-lgpl
Portability problems fixed by either Gnulib module getcwd or
getcwd-lgpl:
<io.h> or
<direct.h>) on some platforms:
mingw, MSVC 14.
getcwd (NULL, n) allocates memory for the result.
On some other platforms, this call is not allowed.
getcwd uses int
instead of size_t for the size argument when using non-standard
headers, and the declaration is missing from <unistd.h>:
mingw, MSVC 14.
getcwd (buf, 0) fails with ERANGE
instead of the required EINVAL:
mingw, MSVC 14.
Portability problems fixed by Gnulib module getcwd:
PATH_MAX)
correctly on some platforms:
glibc on Linux 2.4.20, Mac OS X 10.5, FreeBSD 6.4, NetBSD 5.1, OpenBSD 4.9, AIX 7.1.
Portability problems not fixed by Gnulib:
getcwd(NULL, nonzero), some platforms, such as glibc
or cygwin, allocate exactly nonzero bytes and fail with
ERANGE if it was not big enough, while other platforms, such as
FreeBSD, mingw, or MSVC 14, ignore the size argument and allocate whatever size
is necessary. If this call succeeds, an application cannot portably
access beyond the string length of the result.
Next: getdate_err, Previous: getcwd, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getdatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getdate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Gnulib provides a module parse-datetime that contains a function
parse_datetime
that has similar functionality as the getdate function.
Next: getdelim, Previous: getdate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getdate_errPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getdate_err.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getegid, Previous: getdate_err, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getdelimPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getdelim.html
Gnulib module: getdelim
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getenv, Previous: getdelim, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getegidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getegid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: geteuid, Previous: getegid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getenv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgid, Previous: getenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
geteuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/geteuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrent, Previous: geteuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrgid, Previous: getgid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgrentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgrent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrgid_r, Previous: getgrent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgrgidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgrgid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrnam, Previous: getgrgid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgrgid_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgrgid_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: getgrnam_r, Previous: getgrgid_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgrnamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgrnam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgroups, Previous: getgrnam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgrnam_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgrnam_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: gethostent, Previous: getgrnam_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getgroupsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getgroups.html
Gnulib module: getgroups
Portability problems fixed by Gnulib:
getgroups (0, NULL) always fails. See macro
‘AC_FUNC_GETGROUPS’.
Portability problems not fixed by Gnulib:
fork and exec if
the parent process is multi-threaded.
The Gnulib module mgetgroups provides a similar API.
Next: gethostid, Previous: getgroups, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gethostentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gethostent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostname, Previous: gethostent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gethostidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gethostid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getitimer, Previous: gethostid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gethostnamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gethostname.html
Gnulib module: gethostname
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
int instead of size_t
on some platforms:
OSF/1 5.1, Solaris 10.
EINVAL, instead of returning a truncated host name.
Next: getline, Previous: gethostname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getitimerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getitimer.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getlogin, Previous: getitimer, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getlinePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getline.html
Gnulib module: getline
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getlogin_r, Previous: getline, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getloginPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getlogin.html
Gnulib module: getlogin
Portability problems fixed by Gnulib:
_POSIX is defined on some platforms:
mingw.
Portability problems not fixed by Gnulib:
Next: getmsg, Previous: getlogin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getlogin_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getlogin_r.html
Gnulib module: getlogin_r
Portability problems fixed by Gnulib:
_REENTRANT is defined,
on some platforms:
HP-UX 11.
ERANGE, when the buffer is not large enough, on some platforms:
Mac OS X 10.12, OSF/1 5.1.
Portability problems not fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
EINVAL instead of ERANGE when
the second argument is zero on some platforms:
HP-UX 11.31.
Next: getnameinfo, Previous: getlogin_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetbyaddr, Previous: getmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getnameinfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getnameinfo.html
Gnulib module: getaddrinfo
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetbyname, Previous: getnameinfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getnetbyaddrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getnetbyaddr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetent, Previous: getnetbyaddr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getnetbynamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getnetbyname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getopt, Previous: getnetbyname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getnetentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getnetent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpeername, Previous: getnetent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getoptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getopt.html
Gnulib module: getopt-posix or getopt-gnu
The module getopt-gnu has support for “long options” and for
“options that take optional arguments”. Compared to the API defined by POSIX,
it adds a header file <getopt.h> and a function getopt_long.
Portability problems fixed by either Gnulib module getopt-posix or getopt-gnu:
optind after a missing required argument is wrong
on some platforms:
Mac OS X 10.5, AIX 7.1, mingw.
Portability problems fixed by Gnulib module getopt-gnu:
getopt does not support the ‘+’ flag in the options
string on some platforms:
Mac OS X 10.5, AIX 5.2, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 11 2010-11.
getopt does not obey the combination of ‘+’
and ‘:’ flags in the options string on some platforms:
glibc 2.11.
getopt does not obey the ‘-’ flag in the options
string when POSIXLY_CORRECT is set on some platforms:
Cygwin 1.7.0.
getopt does not support options with optional arguments
on some platforms:
Mac OS X 10.5, OpenBSD 4.0, AIX 5.2, HP-UX 11, IRIX 6.5, OSF/1 5.1,
Solaris 11 2010-11, Cygwin 1.5.x.
getopt_long is missing on some platforms:
AIX 5.1, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 9, MSVC 14, Interix 3.5.
getopt_long does not support abbreviated long options
where all disambiguations are equivalent on some platforms:
OpenBSD 5.0.
getopt_long_only is missing on some platforms:
Mac OS X 10.3, FreeBSD 5.2.1, NetBSD 5.0, AIX 5.1, HP-UX 11, IRIX 6.5,
OSF/1 5.1, Solaris 9, mingw, MSVC 14, Interix 3.5.
W; on some
platforms:
glibc 2.14.
Portability problems not fixed by Gnulib:
getopt allows
mixing option and non-option arguments on the command line in any order.
Other implementations, such as the one in Cygwin, enforce strict POSIX
compliance: they require that the option arguments precede the non-option
arguments. This is something to watch out in your program’s
testsuite.
POSIXLY_CORRECT, by setting
optind to 0. Several BSD implementations provide optreset,
causing a reset by setting it non-zero, although it does not
necessarily re-read POSIXLY_CORRECT. Solaris getopt does
not support either reset method, but does not maintain state that
needs the extra level of reset.
Next: getpgid, Previous: getopt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpeernamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpeername.html
Gnulib module: getpeername
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
_HPUX_ALT_XOPEN_SOCKET_API
is not defined, this function behaves incorrectly because it is declared
to take a pointer to a 64-bit wide socklen_t entity but in fact
considers it as a pointer to a 32-bit wide unsigned int entity.
Portability problems not fixed by Gnulib:
socklen_t type; in this case this function’s
third argument type is ‘int *’.
Next: getpgrp, Previous: getpeername, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpgidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpgid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpid, Previous: getpgid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpgrpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpgrp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpmsg, Previous: getpgrp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getppid, Previous: getpid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpriority, Previous: getpmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getppidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getppid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotobyname, Previous: getppid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpriorityPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpriority.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotobynumber, Previous: getpriority, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getprotobynamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getprotobyname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotoent, Previous: getprotobyname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getprotobynumberPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getprotobynumber.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpwent, Previous: getprotobynumber, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getprotoentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getprotoent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpwnam, Previous: getprotoent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpwentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpwent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpwnam_r, Previous: getpwent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpwnamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpwnam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpwuid, Previous: getpwnam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpwnam_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpwnam_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: getpwuid_r, Previous: getpwnam_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpwuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpwuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
fork and exec if
the parent process is multi-threaded. Instead, use getpwuid_r
prior to forking.
Next: getrlimit, Previous: getpwuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getpwuid_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getpwuid_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
fork and exec if
the parent process is multi-threaded. Use it prior to forking.
Next: getrusage, Previous: getpwuid_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getrlimitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getrlimit.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
rlim_t is a 32-bit type, this function does not
allow to retrieve limits larger than 4 GB, such as for RLIMIT_FSIZE. The
fix is to use the AC_SYS_LARGEFILE macro.
Next: gets, Previous: getrlimit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getrusagePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getrusage.html
Gnulib module: getrusage
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
struct rusage with
meaningful values.
Next: getservbyname, Previous: getrusage, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gets.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
errno
upon failure.
Next: getservbyport, Previous: gets, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getservbynamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getservbyname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getservent, Previous: getservbyname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getservbyportPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getservbyport.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsid, Previous: getservbyport, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getserventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getservent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsockname, Previous: getservent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getsidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getsid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsockopt, Previous: getsid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getsocknamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getsockname.html
Gnulib module: getsockname
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
_HPUX_ALT_XOPEN_SOCKET_API
is not defined, this function behaves incorrectly because it is declared
to take a pointer to a 64-bit wide socklen_t entity but in fact
considers it as a pointer to a 32-bit wide unsigned int entity.
Portability problems not fixed by Gnulib:
socklen_t type; in this case this function’s
third argument type is ‘int *’.
Next: getsubopt, Previous: getsockname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getsockoptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getsockopt.html
Gnulib module: getsockopt
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
_HPUX_ALT_XOPEN_SOCKET_API
is not defined, this function behaves incorrectly because it is declared
to take a pointer to a 64-bit wide socklen_t entity but in fact
considers it as a pointer to a 32-bit wide unsigned int entity.
Portability problems not fixed by Gnulib:
socklen_t type; in this case this function’s
fifth argument type is ‘int *’.
setsockopt function, but not the getsockopt
function.
Next: gettimeofday, Previous: getsockopt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getsuboptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getsubopt.html
Gnulib module: getsubopt
Portability problems fixed by Gnulib:
unistd.h instead of
stdlib.h on some platforms:
Cygwin 1.7.1.
Portability problems not fixed by Gnulib:
Next: getuid, Previous: getsubopt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gettimeofdayPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gettimeofday.html
Gnulib module: gettimeofday
Portability problems fixed by Gnulib:
struct
timezone* rather than void *, making it an error to redeclare
the function with the POSIX signature:
glibc.
However, rather than penalize these systems with a replacement
function, gnulib defines GETTIMEOFDAY_TIMEZONE to the
appropriate type for use in avoiding a compiler warning if assigning
gettimeofday to a function pointer.
gettimeofday clobbers the buffer in which
localtime returns its result:
Mac OS X 10.0.
Portability problems not fixed by Gnulib:
gettimeofday
is not NULL.
Next: getutxent, Previous: gettimeofday, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutxid, Previous: getuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getutxentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getutxent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutxline, Previous: getutxent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getutxidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getutxid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getwc, Previous: getutxid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getutxlinePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getutxline.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getwchar, Previous: getutxline, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getwcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getwc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: glob, Previous: getwc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
getwcharPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/getwchar.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: globfree, Previous: getwchar, Up: ISO C and POSIX Function Substitutes [Contents][Index]
globPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/glob.html
Gnulib module: glob
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB.
(Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
gl_flags field.
Next: gmtime, Previous: glob, Up: ISO C and POSIX Function Substitutes [Contents][Index]
globfreePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/globfree.html
Gnulib module: glob
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gmtime_r, Previous: globfree, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gmtimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gmtime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: grantpt, Previous: gmtime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
gmtime_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/gmtime_r.html
Gnulib module: time_r
Portability problems fixed by Gnulib:
_REENTRANT is defined,
on some platforms:
HP-UX 11.
Portability problems not fixed by Gnulib:
Next: hcreate, Previous: gmtime_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
grantptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/grantpt.html
Gnulib module: grantpt
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hdestroy, Previous: grantpt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hcreatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hcreate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hsearch, Previous: hcreate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hdestroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hdestroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: htonl, Previous: hdestroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hsearchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hsearch.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: htons, Previous: hsearch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
htonlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/htonl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hypot, Previous: htonl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
htonsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/htons.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hypotf, Previous: htons, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hypotPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hypot.html
Gnulib module: hypot or hypot-ieee
Portability problems fixed by either Gnulib module hypot or hypot-ieee:
Portability problems fixed by Gnulib module hypot-ieee:
Portability problems not fixed by Gnulib:
Next: hypotl, Previous: hypot, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hypotfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hypotf.html
Gnulib module: hypotf or hypotf-ieee
Portability problems fixed by either Gnulib module hypotf or hypotf-ieee:
Portability problems fixed by Gnulib module hypot-ieee:
Portability problems not fixed by Gnulib:
Next: iconv, Previous: hypotf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
hypotlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/hypotl.html
Gnulib module: hypotl or hypotl-ieee
Portability problems fixed by either Gnulib module hypotl or hypotl-ieee:
Portability problems fixed by Gnulib module hypotl-ieee:
Portability problems not fixed by Gnulib:
Next: iconv_close, Previous: hypotl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iconvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iconv.html
Gnulib module: iconv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
iconv encounters an input character that is valid but that
cannot be converted to the output character set, glibc’s and GNU libiconv’s
iconv stop the conversion. Some other implementations put an
implementation-defined character into the output buffer.
Gnulib provides higher-level facilities striconv and striconveh
(wrappers around iconv) that deal with conversion errors in a platform
independent way.
Next: iconv_open, Previous: iconv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iconv_closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iconv_close.html
Gnulib module: iconv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: if_freenameindex, Previous: iconv_close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iconv_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iconv_open.html
Gnulib module: iconv, iconv_open, iconv_open-utf
Portability problems fixed by either Gnulib module iconv or iconv_open:
Portability problems fixed by Gnulib module iconv_open:
Portability problems fixed by Gnulib module iconv_open-utf:
Portability problems not fixed by Gnulib:
striconveh (a wrapper around iconv) that deals with
this problem.
Next: if_indextoname, Previous: iconv_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
if_freenameindexPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/if_freenameindex.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: if_nameindex, Previous: if_freenameindex, Up: ISO C and POSIX Function Substitutes [Contents][Index]
if_indextonamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/if_indextoname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: if_nametoindex, Previous: if_indextoname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
if_nameindexPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/if_nameindex.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ilogb, Previous: if_nameindex, Up: ISO C and POSIX Function Substitutes [Contents][Index]
if_nametoindexPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/if_nametoindex.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ilogbf, Previous: if_nametoindex, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ilogbPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ilogb.html
Gnulib module: ilogb
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ilogbl, Previous: ilogb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ilogbfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ilogbf.html
Gnulib module: ilogbf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: imaxabs, Previous: ilogbf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ilogblPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ilogbl.html
Gnulib module: ilogbl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: imaxdiv, Previous: ilogbl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
imaxabsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/imaxabs.html
Gnulib module: imaxabs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_addr, Previous: imaxabs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
imaxdivPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/imaxdiv.html
Gnulib module: imaxdiv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_ntoa, Previous: imaxdiv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
inet_addrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/inet_addr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_ntop, Previous: inet_addr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
inet_ntoaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/inet_ntoa.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
inet_ntoa function need not be reentrant, and consequently
is not required to be thread safe. Implementations of
inet_ntoa typically write the timestamp into static buffer.
If two threads call inet_ntoa at roughly the same time, you
might end up with the wrong date in one of the threads, or some
undefined string.
Note: inet_ntoa is specific for IPv4 addresses.
A protocol independent function is inet_ntop.
Next: inet_pton, Previous: inet_ntoa, Up: ISO C and POSIX Function Substitutes [Contents][Index]
inet_ntopPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/inet_ntop.html
Gnulib module: inet_ntop
Portability problems fixed by Gnulib:
<netdb.h> instead of <arpa/inet.h>
on some platforms:
NonStop Kernel.
<ws2tcpip.h>, with a POSIX incompatible
declaration, on some platforms:
MSVC 14 on Windows >= Vista.
Portability problems not fixed by Gnulib:
size_t instead of
socklen_t on some platforms:
OSF/1 5.1, Solaris 10.
Next: initstate, Previous: inet_ntop, Up: ISO C and POSIX Function Substitutes [Contents][Index]
inet_ptonPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/inet_pton.html
Gnulib module: inet_pton
Portability problems fixed by Gnulib:
<netdb.h> instead of <arpa/inet.h>
on some platforms:
NonStop Kernel.
<ws2tcpip.h>, with a POSIX incompatible
declaration, on some platforms:
MSVC 14 on Windows >= Vista.
Portability problems not fixed by Gnulib:
Next: insque, Previous: inet_pton, Up: ISO C and POSIX Function Substitutes [Contents][Index]
initstatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/initstate.html
Gnulib module: random
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ioctl, Previous: initstate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
insquePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/insque.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isalnum, Previous: insque, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ioctlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ioctl.html
Gnulib module: ioctl
Portability problems fixed by Gnulib:
ioctl is called
ioctlsocket, and error codes from this function are not placed in
errno, and WSAGetLastError must be used instead.
unsigned long rather than int
on some platforms:
glibc 2.26, Mac OS X 10.5, FreeBSD 11.0, NetBSD 7.0, OpenBSD 6.0, BeOS, Haiku 2017.
Portability problems not fixed by Gnulib:
ioctl requests are platform and hardware specific.
Next: isalnum_l, Previous: ioctl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isalnumPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isalnum.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isalnumThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswalnumThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isalnumThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_alnumThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-alnum’.
Next: isalpha, Previous: isalnum, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isalnum_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isalnum_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isalpha_l, Previous: isalnum_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isalphaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isalpha.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isalphaThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswalphaThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isalphaThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_alphaThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-alpha’.
Next: isascii, Previous: isalpha, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isalpha_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isalpha_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isastream, Previous: isalpha_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isasciiPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isascii.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but requires special
handling for the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are two alternative APIs:
c_isasciiThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
mb_isasciiThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
Next: isatty, Previous: isascii, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isastreamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isastream.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isblank, Previous: isastream, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isattyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isatty.html
Gnulib module: isatty
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isblank_l, Previous: isatty, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isblankPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isblank.html
Gnulib module: isblank
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isblankThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswblankThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isblankThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_blankThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-blank’.
Next: iscntrl, Previous: isblank, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isblank_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isblank_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: iscntrl_l, Previous: isblank_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iscntrlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iscntrl.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_iscntrlThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswcntrlThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_iscntrlThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_cntrlThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-cntrl’.
Next: isdigit, Previous: iscntrl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iscntrl_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iscntrl_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isdigit_l, Previous: iscntrl_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isdigitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isdigit.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isdigitThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswdigitThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isdigitThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_digitThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-digit’.
Next: isfinite, Previous: isdigit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isdigit_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isdigit_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isgraph, Previous: isdigit_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isfinitePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isfinite.html
Gnulib module: isfinite
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
isfinite raises an
exception given a signaling NaN operand.
Next: isgraph_l, Previous: isfinite, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isgraphPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isgraph.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isgraphThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswgraphThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isgraphThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_graphThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-graph’.
Next: isgreater, Previous: isgraph, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isgraph_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isgraph_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isgreaterequal, Previous: isgraph_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isgreaterPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isgreater.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isinf, Previous: isgreater, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isgreaterequalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isgreaterequal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isless, Previous: isgreaterequal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isinfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isinf.html
Gnulib module: isinf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: islessequal, Previous: isinf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
islessPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isless.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: islessgreater, Previous: isless, Up: ISO C and POSIX Function Substitutes [Contents][Index]
islessequalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/islessequal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: islower, Previous: islessequal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
islessgreaterPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/islessgreater.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: islower_l, Previous: islessgreater, Up: ISO C and POSIX Function Substitutes [Contents][Index]
islowerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/islower.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_islowerThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswlowerThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_islowerThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_lowerThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-lower’.
Next: isnan, Previous: islower, Up: ISO C and POSIX Function Substitutes [Contents][Index]
islower_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/islower_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isnormal, Previous: islower_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isnanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isnan.html
Gnulib module: isnan
Portability problems fixed by Gnulib:
isnan was introduced with C99 and is thus commonly not present
on pre-C99 systems.
isnan is not a macro on some platforms:
IRIX 6.5, OSF/1 5.1 with gcc, Solaris 11.3.
cc, isnan does not recognize some NaNs.
Portability problems not fixed by Gnulib:
Next: isprint, Previous: isnan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isnormalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isnormal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isprint_l, Previous: isnormal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isprintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isprint.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isprintThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswprintThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isprintThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_printThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-print’.
Next: ispunct, Previous: isprint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isprint_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isprint_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ispunct_l, Previous: isprint_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ispunctPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ispunct.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_ispunctThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswpunctThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_ispunctThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_punctThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-punct’.
Next: isspace, Previous: ispunct, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ispunct_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ispunct_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isspace_l, Previous: ispunct_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isspacePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isspace.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isspaceThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswspaceThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isspaceThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_spaceThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-space’.
Next: isunordered, Previous: isspace, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isspace_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isspace_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isupper, Previous: isspace_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isunorderedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isunordered.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isupper_l, Previous: isunordered, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isupperPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isupper.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isupperThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswupperThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isupperThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_upperThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-upper’.
Next: iswalnum, Previous: isupper, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isupper_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isupper_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: iswalnum_l, Previous: isupper_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswalnumPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswalnum.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswalpha, Previous: iswalnum, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswalnum_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswalnum_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswalpha_l, Previous: iswalnum_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswalphaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswalpha.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswblank, Previous: iswalpha, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswalpha_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswalpha_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswblank_l, Previous: iswalpha_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswblankPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswblank.html
Gnulib module: iswblank
Portability problems fixed by Gnulib:
-D_GNU_SOURCE) on some platforms:
glibc 2.8.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswcntrl, Previous: iswblank, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswblank_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswblank_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswcntrl_l, Previous: iswblank_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswcntrlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswcntrl.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswctype, Previous: iswcntrl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswcntrl_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswcntrl_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswctype_l, Previous: iswcntrl_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswctypePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswctype.html
Gnulib module: iswctype
Portability problems fixed by Gnulib:
<wchar.h>, not in <wctype.h>, on
some platforms:
HP-UX 11.00.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswdigit, Previous: iswctype, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswctype_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswctype_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswdigit_l, Previous: iswctype_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswdigitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswdigit.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswgraph, Previous: iswdigit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswdigit_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswdigit_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswgraph_l, Previous: iswdigit_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswgraphPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswgraph.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswlower, Previous: iswgraph, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswgraph_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswgraph_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswlower_l, Previous: iswgraph_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswlowerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswlower.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswprint, Previous: iswlower, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswlower_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswlower_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswprint_l, Previous: iswlower_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswprintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswprint.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswpunct, Previous: iswprint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswprint_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswprint_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswpunct_l, Previous: iswprint_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswpunctPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswpunct.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswspace, Previous: iswpunct, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswpunct_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswpunct_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswspace_l, Previous: iswpunct_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswspacePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswspace.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswupper, Previous: iswspace, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswspace_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswspace_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswupper_l, Previous: iswspace_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswupperPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswupper.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswxdigit, Previous: iswupper, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswupper_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswupper_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: iswxdigit_l, Previous: iswupper_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswxdigitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswxdigit.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: isxdigit, Previous: iswxdigit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
iswxdigit_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/iswxdigit_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: isxdigit_l, Previous: iswxdigit_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isxdigitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isxdigit.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function’s behaviour depends on the locale, but does not support
the multibyte characters that occur in strings in locales with
MB_CUR_MAX > 1 (this includes all the common UTF-8 locales).
There are four alternative APIs:
c_isxdigitThis function operates in a locale independent way and returns true only for ASCII characters. It is provided by the Gnulib module ‘c-ctype’.
iswxdigitThis function operates in a locale dependent way, on wide characters. In
order to use it, you first have to convert from multibyte to wide characters,
using the mbrtowc function. It is provided by the Gnulib module
‘wctype’.
mb_isxdigitThis function operates in a locale dependent way, on multibyte characters. It is provided by the Gnulib module ‘mbchar’.
uc_is_xdigitThis function operates in a locale independent way, on Unicode characters. It is provided by the Gnulib module ‘unictype/ctype-xdigit’.
Next: j0, Previous: isxdigit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
isxdigit_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/isxdigit_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: j1, Previous: isxdigit_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
j0POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/j0.html
Gnulib module: j0
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: jn, Previous: j0, Up: ISO C and POSIX Function Substitutes [Contents][Index]
j1POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/j1.html
Gnulib module: j1
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: jrand48, Previous: j1, Up: ISO C and POSIX Function Substitutes [Contents][Index]
jnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/jn.html
Gnulib module: jn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: kill, Previous: jn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
jrand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/jrand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: killpg, Previous: jrand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
killPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/kill.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: l64a, Previous: kill, Up: ISO C and POSIX Function Substitutes [Contents][Index]
killpgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/killpg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: labs, Previous: killpg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
l64aPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/l64a.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lchown, Previous: l64a, Up: ISO C and POSIX Function Substitutes [Contents][Index]
labsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/labs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lcong48, Previous: labs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lchownPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lchown.html
Gnulib module: lchown
Portability problems fixed by Gnulib:
lchown("link-to-file/",uid,gid):
FreeBSD 7.2, Solaris 9.
lchmod, the replacement only fixes this for non-symlinks:
OpenBSD 4.0.
chown is supported, and fails altogether
with ENOSYS otherwise:
Mac OS X 10.3, Minix 3.1.8, mingw, MSVC 14, BeOS.
Portability problems not fixed by Gnulib:
Next: ldexp, Previous: lchown, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lcong48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lcong48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ldexpf, Previous: lcong48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ldexpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ldexp.html
Gnulib module: ldexp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ldexpl, Previous: ldexp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ldexpfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ldexpf.html
Gnulib module: ldexpf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ldiv, Previous: ldexpf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ldexplPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ldexpl.html
Gnulib module: ldexpl
Portability problems fixed by Gnulib:
<math.h> on some platforms:
Mac OS X.
Portability problems not fixed by Gnulib:
Next: lfind, Previous: ldexpl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ldivPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ldiv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgamma, Previous: ldiv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lfindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lfind.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgammaf, Previous: lfind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lgammaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lgamma.html
Gnulib module: lgamma
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgammal, Previous: lgamma, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lgammafPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lgammaf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: link, Previous: lgammaf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lgammalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lgammal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: linkat, Previous: lgammal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
linkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/link.html
Gnulib module: link
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lio_listio, Previous: link, Up: ISO C and POSIX Function Substitutes [Contents][Index]
linkatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/linkat.html
Gnulib module: linkat
Portability problems fixed by Gnulib:
AT_SYMLINK_FOLLOW on some platforms:
Linux kernel 2.6.17.
Portability problems not fixed by Gnulib:
Next: listen, Previous: linkat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lio_listioPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lio_listio.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: llabs, Previous: lio_listio, Up: ISO C and POSIX Function Substitutes [Contents][Index]
listenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/listen.html
Gnulib module: listen
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: lldiv, Previous: listen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llabsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llabs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llrint, Previous: llabs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lldivPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lldiv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llrintf, Previous: lldiv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llrintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llrint.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llrintl, Previous: llrint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llrintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llrintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llround, Previous: llrintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llrintlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llrintl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llroundf, Previous: llrintl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llroundPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llround.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llroundl, Previous: llround, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llroundfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llroundf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: localeconv, Previous: llroundf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
llroundlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/llroundl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: localtime, Previous: llroundl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
localeconvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/localeconv.html
Gnulib module: localeconv
Portability problems fixed by Gnulib:
struct lconv type does not contain any members on some platforms:
Android up to 2014.
struct lconv type does not contain the members
int_p_cs_precedes, int_p_sign_posn, int_p_sep_by_space,
int_n_cs_precedes, int_n_sign_posn, int_n_sep_by_space
on some platforms:
glibc, OpenBSD 4.9, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 11.3, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: localtime_r, Previous: localeconv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
localtimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/localtime.html
Gnulib module: localtime
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
Portability problems not fixed by Gnulib:
time_rz module to work around the problem.
tzset.
Next: lockf, Previous: localtime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
localtime_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/localtime_r.html
Gnulib module: time_r
Portability problems fixed by Gnulib:
_REENTRANT is defined,
on some platforms:
HP-UX 11.
Portability problems not fixed by Gnulib:
time_rz module to work around the problem.
Next: log, Previous: localtime_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lockfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lockf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly across the entire data range of files larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: log10, Previous: lockf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
logPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log.html
Gnulib module: log or log-ieee
Portability problems fixed by either Gnulib module log or log-ieee:
Portability problems fixed by Gnulib module log-ieee:
Portability problems not fixed by Gnulib:
Next: log10f, Previous: log, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log10POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log10.html
Gnulib module: log10 or log10-ieee
Portability problems fixed by either Gnulib module log10 or log10-ieee:
Portability problems fixed by Gnulib module log10-ieee:
Portability problems not fixed by Gnulib:
Next: log10l, Previous: log10, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log10fPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log10f.html
Gnulib module: log10f or log10f-ieee
Portability problems fixed by either Gnulib module log10f or log10f-ieee:
Portability problems fixed by Gnulib module log10f-ieee:
Portability problems not fixed by Gnulib:
Next: log1p, Previous: log10f, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log10lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log10l.html
Gnulib module: log10l
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: log1pf, Previous: log10l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log1pPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log1p.html
Gnulib module: log1p or log1p-ieee
Portability problems fixed by either Gnulib module log1p or log1p-ieee:
Portability problems fixed by Gnulib module log1p-ieee:
Portability problems not fixed by Gnulib:
Next: log1pl, Previous: log1p, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log1pfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log1pf.html
Gnulib module: log1pf or log1pf-ieee
Portability problems fixed by either Gnulib module log1pf or log1pf-ieee:
-1.0f on some platforms:
IRIX 6.5.
Portability problems fixed by Gnulib module log1pf-ieee:
Portability problems not fixed by Gnulib:
Next: log2, Previous: log1pf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log1plPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log1pl.html
Gnulib module: log1pl or log1pl-ieee
Portability problems fixed by either Gnulib module log1pl or log1pl-ieee:
Portability problems fixed by Gnulib module log1pl-ieee:
Portability problems not fixed by Gnulib:
Next: log2f, Previous: log1pl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log2POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log2.html
Gnulib module: log2 or log2-ieee
Portability problems fixed by either Gnulib module log2 or log2-ieee:
Portability problems fixed by Gnulib module log2-ieee:
Portability problems not fixed by Gnulib:
Next: log2l, Previous: log2, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log2fPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log2f.html
Gnulib module: log2f or log2f-ieee
Portability problems fixed by either Gnulib module log2f or log2f-ieee:
Portability problems fixed by Gnulib module log2f-ieee:
Portability problems not fixed by Gnulib:
Next: logb, Previous: log2f, Up: ISO C and POSIX Function Substitutes [Contents][Index]
log2lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/log2l.html
Gnulib module: log2l
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: logbf, Previous: log2l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
logbPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/logb.html
Gnulib module: logb
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: logbl, Previous: logb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
logbfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/logbf.html
Gnulib module: logbf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: logf, Previous: logbf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
logblPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/logbl.html
Gnulib module: logbl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: logl, Previous: logbl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
logfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/logf.html
Gnulib module: logf or logf-ieee
Portability problems fixed by either Gnulib module logf or logf-ieee:
Portability problems fixed by Gnulib module logf-ieee:
Portability problems not fixed by Gnulib:
Next: longjmp, Previous: logf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
loglPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/logl.html
Gnulib module: logl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lrand48, Previous: logl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
longjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/longjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sigaltstack), on FreeBSD, NetBSD,
OpenBSD, you need to clear the SS_ONSTACK flag in the stack_t
structure managed by the kernel.
Next: lrint, Previous: longjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lrand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lrand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lrintf, Previous: lrand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lrintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lrint.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lrintl, Previous: lrint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lrintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lrintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lround, Previous: lrintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lrintlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lrintl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lroundf, Previous: lrintl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lroundPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lround.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lroundl, Previous: lround, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lroundfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lroundf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lsearch, Previous: lroundf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lroundlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lroundl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lseek, Previous: lroundl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lsearchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lsearch.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lstat, Previous: lsearch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lseekPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lseek.html
Gnulib module: lseek
Portability problems fixed by Gnulib:
off_t is a 32-bit type, lseek does not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
lseek should set
errno to EINVAL and return -1, but in this situation a
SIGSYS signal is raised on some platforms:
IRIX 6.5.
lseek function fails, POSIX says that the file offset remains
unchanged. But on some platforms, attempting to set a negative file offset
fails and sets the file offset to 0:
BeOS.
Next: malloc, Previous: lseek, Up: ISO C and POSIX Function Substitutes [Contents][Index]
lstatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/lstat.html
Gnulib module: lstat
Portability problems fixed by Gnulib:
off_t is a 32-bit type, lstat may not
correctly report the size of files or block devices larger than 2 GB.
(Cf. AC_SYS_LARGEFILE.)
lstat("file/",buf) succeeds instead of
failing with ENOTDIR.
Solaris 9.
tv_sec value, tv_nsec might be in the range
-1000000000..-1, representing a negative nanoseconds
offset from tv_sec.
lstat does not exist.
Portability problems not fixed by Gnulib:
struct stat.
Next: mblen, Previous: lstat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mallocPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/malloc.html
Gnulib module: malloc-posix
Portability problems fixed by Gnulib:
errno to ENOMEM on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
malloc (0) always returns a NULL pointer on some platforms:
AIX 5.1, OSF/1 5.1.
Extension: Gnulib provides a module ‘malloc-gnu’ that substitutes a
malloc implementation that behaves more like the glibc implementation,
regarding the result of malloc (0).
Next: mbrlen, Previous: malloc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mblenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mblen.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mbrtoc16, Previous: mblen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbrlenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbrlen.html
Gnulib module: mbrlen
Portability problems fixed by Gnulib:
(size_t) -1
and set errno to EILSEQ:
glibc 2.23.
(size_t) -2 when the input
is empty:
glibc 2.19.
(size_t) -1 instead of (size_t) -2
when the input is empty:
AIX 5.1.
Portability problems not fixed by Gnulib:
Next: mbrtoc32, Previous: mbrlen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbrtoc16Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mbrtowc, Previous: mbrtoc16, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbrtoc32Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mbsinit, Previous: mbrtoc32, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbrtowcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbrtowc.html
Gnulib module: mbrtowc
Portability problems fixed by Gnulib:
(size_t) -1
and set errno to EILSEQ:
glibc 2.23.
(size_t) -2 when the input
is empty:
glibc 2.19.
(size_t) -1 instead of (size_t) -2
when the input is empty:
AIX 5.1.
pwc argument is NULL on some platforms:
Solaris 7.
pwc argument if the string argument is
NULL on some platforms:
OSF/1 5.1.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: mbsnrtowcs, Previous: mbrtowc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbsinitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbsinit.html
Gnulib module: mbsinit
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mbsrtowcs, Previous: mbsinit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbsnrtowcsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbsnrtowcs.html
Gnulib module: mbsnrtowcs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: mbstowcs, Previous: mbsnrtowcs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbsrtowcsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbsrtowcs.html
Gnulib module: mbsrtowcs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: mbtowc, Previous: mbsrtowcs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbstowcsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbstowcs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: memccpy, Previous: mbstowcs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mbtowcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mbtowc.html
Gnulib module: mbtowc
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: memchr, Previous: mbtowc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memccpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memccpy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memcmp, Previous: memccpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memchrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memchr.html
Gnulib module: memchr or memchr-obsolete
Portability problems fixed by either Gnulib module memchr or memchr-obsolete:
Portability problems fixed by Gnulib module memchr-obsolete:
Portability problems not fixed by Gnulib:
Next: memcpy, Previous: memchr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memcmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memcmp.html
Gnulib module: memcmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memmove, Previous: memcmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memcpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memcpy.html
Gnulib module: memcpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memset, Previous: memcpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memmovePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memmove.html
Gnulib module: memmove
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkdir, Previous: memmove, Up: ISO C and POSIX Function Substitutes [Contents][Index]
memsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/memset.html
Gnulib module: memset
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkdirat, Previous: memset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkdir.html
Gnulib module: mkdir
Portability problems fixed by Gnulib:
<io.h> or
<direct.h>) on some platforms:
mingw, MSVC 14.
_mkdir
and takes only one argument. The fix (without Gnulib) is to define a macro
like this:
#define mkdir ((int (*)()) _mkdir)
or
#define mkdir(path,mode) _mkdir (path)
Portability problems not fixed by Gnulib:
Next: mkdtemp, Previous: mkdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkdiratPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkdirat.html
Gnulib module: mkdirat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkfifo, Previous: mkdirat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkdtempPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkdtemp.html
Gnulib module: mkdtemp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkfifoat, Previous: mkdtemp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkfifoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkfifo.html
Gnulib module: mkfifo
Portability problems fixed by Gnulib:
ENOSYS:
mingw, MSVC 14, Android 4.4.
Portability problems not fixed by Gnulib:
EISDIR instead of the correct EEXIST:
HP-UX 11.11.
Next: mknod, Previous: mkfifo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkfifoatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkfifoat.html
Gnulib module: mkfifoat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
EISDIR instead of the correct
EEXIST: HP-UX 11.11.
Next: mknodat, Previous: mkfifoat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mknodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mknod.html
Gnulib module: mknod
Portability problems fixed by Gnulib:
ENOSYS:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EISDIR instead of the correct EEXIST:
HP-UX 11.11.
Next: mkstemp, Previous: mknod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mknodatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mknodat.html
Gnulib module: mkfifoat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
EISDIR instead of the correct
EEXIST: HP-UX 11.11.
Next: mktime, Previous: mknodat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mkstempPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mkstemp.html
Gnulib module: mkstemp
Portability problems fixed by Gnulib:
<unistd.h> instead of <stdlib.h>
on some platforms:
Mac OS X 10.3.
off_t is a 32-bit type, mkstemp may not work
correctly to create files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
mkstemp can create a world or group
writable or readable file, if you haven’t set the process umask to
077. This is a security risk.
Portability problems not fixed by Gnulib:
The gnulib module clean-temp can create temporary files that will not
be left behind after signals such as SIGINT.
Next: mlock, Previous: mkstemp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mktimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mktime.html
Gnulib module: mktime
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
mktime may go into an endless loop on some platforms.
mktime may occasionally return wrong results on some platforms.
Portability problems not fixed by Gnulib:
tzset.
Next: mlockall, Previous: mktime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mmap, Previous: mlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mlockallPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mlockall.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: modf, Previous: mlockall, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mmapPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mmap.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly across the entire data range of files larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
MAP_ANONYMOUS | MAP_PRIVATE and -1 instead of a file descriptor;
on others you have to use a read-only file descriptor of /dev/zero.
MAP_FIXED, often causes mmap to fail. Better pass NULL
in this case.
MAP_FIXED basically never works. On other platforms, it depends
on the circumstances whether memory can be returned at a given address.
Next: modff, Previous: mmap, Up: ISO C and POSIX Function Substitutes [Contents][Index]
modfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/modf.html
Gnulib module: modf or modf-ieee
Portability problems fixed by either Gnulib module modf or modf-ieee:
Portability problems fixed by Gnulib module modf-ieee:
Portability problems not fixed by Gnulib:
Next: modfl, Previous: modf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
modffPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/modff.html
Gnulib module: modff or modff-ieee
Portability problems fixed by either Gnulib module modff or modff-ieee:
Portability problems fixed by Gnulib module modff-ieee:
Portability problems not fixed by Gnulib:
Next: mprotect, Previous: modff, Up: ISO C and POSIX Function Substitutes [Contents][Index]
modflPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/modfl.html
Gnulib module: modfl or modfl-ieee
Portability problems fixed by either Gnulib module modfl or modfl-ieee:
Portability problems fixed by Gnulib module modfl-ieee:
Portability problems not fixed by Gnulib:
Next: mq_close, Previous: modfl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mprotectPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mprotect.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno on some platforms:
mingw.
mprotect on memory regions allocated
with malloc.
Next: mq_getattr, Previous: mprotect, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_close.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_notify, Previous: mq_close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_getattrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_getattr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_open, Previous: mq_getattr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_notifyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_notify.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_receive, Previous: mq_notify, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_send, Previous: mq_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_receivePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_receive.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_setattr, Previous: mq_receive, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_sendPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_send.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_timedreceive, Previous: mq_send, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_setattrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_setattr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_timedsend, Previous: mq_setattr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_timedreceivePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_timedreceive.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mq_unlink, Previous: mq_timedreceive, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_timedsendPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_timedsend.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mrand48, Previous: mq_timedsend, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mq_unlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mq_unlink.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: msgctl, Previous: mq_unlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
mrand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/mrand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: msgget, Previous: mrand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
msgctlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/msgctl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: msgrcv, Previous: msgctl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
msggetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/msgget.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: msgsnd, Previous: msgget, Up: ISO C and POSIX Function Substitutes [Contents][Index]
msgrcvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/msgrcv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: msync, Previous: msgrcv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
msgsndPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/msgsnd.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: munlock, Previous: msgsnd, Up: ISO C and POSIX Function Substitutes [Contents][Index]
msyncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/msync.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
msync takes only two arguments.
Next: munlockall, Previous: msync, Up: ISO C and POSIX Function Substitutes [Contents][Index]
munlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/munlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: munmap, Previous: munlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
munlockallPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/munlockall.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nan, Previous: munlockall, Up: ISO C and POSIX Function Substitutes [Contents][Index]
munmapPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/munmap.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nanf, Previous: munmap, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nan.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nanl, Previous: nan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nanosleep, Previous: nanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nanlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nanl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nearbyint, Previous: nanl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nanosleepPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nanosleep.html
Gnulib module: nanosleep
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nearbyintf, Previous: nanosleep, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nearbyintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nearbyint.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nearbyintl, Previous: nearbyint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nearbyintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nearbyintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: newlocale, Previous: nearbyintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nearbyintlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nearbyintl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nextafter, Previous: nearbyintl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
newlocalePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/newlocale.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nextafterf, Previous: newlocale, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nextafterPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nextafter.html
Gnulib module: nextafter
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nextafterl, Previous: nextafter, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nextafterfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nextafterf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nexttoward, Previous: nextafterf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nextafterlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nextafterl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nexttowardf, Previous: nextafterl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nexttowardPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nexttoward.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nexttowardl, Previous: nexttoward, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nexttowardfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nexttowardf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nftw, Previous: nexttowardf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nexttowardlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nexttowardl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nice, Previous: nexttowardl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nftwPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nftw.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
correctly report the size of files or block devices larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: nl_langinfo, Previous: nftw, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nicePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nice.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
nice returned 0 upon success.
Next: nl_langinfo_l, Previous: nice, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nl_langinfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nl_langinfo.html
Gnulib module: nl_langinfo
Portability problems fixed by Gnulib:
CODESET is not supported on some platforms:
glibc 2.0.6, OpenBSD 3.8.
ALTMON_1 to ALTMON_12 are not defined on some
platforms:
glibc 2.26 and many others.
ERA, ERA_D_FMT, ERA_D_T_FMT,
ERA_T_FMT, ALT_DIGITS are not supported on some platforms:
OpenBSD 3.8.
T_FMT_AMPM, YESEXPR, NOEXPR are not
supported on some platforms:
IRIX 5.3.
YESEXPR and NOEXPR do not return a valid
string on some platforms:
Irix 6.5.
Portability problems not fixed by Gnulib:
nl_langinfo(CODESET) always
returns "US-ASCII".
nl_langinfo(CRNCYSTR) returns the
empty string, although the local currency symbol, as returned by
localeconv()->currency_symbol, is non-empty.
nl_langinfo(ABMON_1) ... nl_langinfo(ABMON_12) are full month
names, not abbreviated month names.
Next: nrand48, Previous: nl_langinfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nl_langinfo_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nl_langinfo_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ntohl, Previous: nl_langinfo_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
nrand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/nrand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ntohs, Previous: nrand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ntohlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ntohl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: open, Previous: ntohl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ntohsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ntohs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: openat, Previous: ntohs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/open.html
Gnulib module: open, fchdir
Portability problems fixed by the Gnulib module open:
O_CLOEXEC:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, Minix 3.1.8, AIX 5.1, HP-UX 11, IRIX 6.5, OSF/1 5.1, Solaris 10, Cygwin, mingw, MSVC 14, Interix 3.5.
off_t is a 32-bit type, open may not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
O_NONBLOCK flag when it is defined
by the gnulib module nonblocking on some platforms:
mingw, MSVC 14.
Portability problems fixed by the Gnulib module fchdir:
Portability problems not fixed by Gnulib:
O_CLOEXEC is not atomic, and so is
not safe in the presence of multiple threads or signal handlers.
open ("symlink", O_NOFOLLOW ...) fails with errno set to
EMLINK instead of the POSIX-required ELOOP on some
platforms:
FreeBSD 10.1.
open ("symlink", O_NOFOLLOW ...) fails with errno set to
EFTYPE instead of the POSIX-required ELOOP on some
platforms:
NetBSD 6.1.
O_TEXT mode by
default; this means that it translates '\n' to CR/LF by default. Use the
O_BINARY flag if you need reliable binary I/O.
Next: opendir, Previous: open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
openatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/openat.html
Gnulib module: openat
Portability problems fixed by Gnulib:
O_CLOEXEC:
AIX 7.1, Solaris 10.
off_t is a 32-bit type, open may not work
correctly with files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
O_CLOEXEC is not atomic, and so is
not safe in the presence of multiple threads or signal handlers.
openat (fd, "symlink", O_NOFOLLOW ...) fails with errno
set to EMLINK instead of the POSIX-required ELOOP on
some platforms:
FreeBSD 10.1.
openat (fd, "symlink", O_NOFOLLOW ...) fails with errno
set to EFTYPE instead of the POSIX-required ELOOP on
some platforms:
NetBSD 6.1.
Next: openlog, Previous: openat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
opendirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/opendir.html
Gnulib module: opendir
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. Also, on platforms
where ino_t is a 32-bit type, this function may report inode numbers
incorrectly. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
Next: open_memstream, Previous: opendir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
openlogPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/openlog.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: open_wmemstream, Previous: openlog, Up: ISO C and POSIX Function Substitutes [Contents][Index]
open_memstreamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/open_memstream.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: optarg, Previous: open_memstream, Up: ISO C and POSIX Function Substitutes [Contents][Index]
open_wmemstreamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/open_wmemstream.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: opterr, Previous: open_wmemstream, Up: ISO C and POSIX Function Substitutes [Contents][Index]
optargPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/optarg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: optind, Previous: optarg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
opterrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/opterr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: optopt, Previous: opterr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
optindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/optind.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pathconf, Previous: optind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
optoptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/optopt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pause, Previous: optopt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pathconfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pathconf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pclose, Previous: pathconf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pausePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pause.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: perror, Previous: pause, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pclosePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pclose.html
Gnulib module: pclose
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pipe, Previous: pclose, Up: ISO C and POSIX Function Substitutes [Contents][Index]
perrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/perror.html
Gnulib module: perror
Portability problems fixed by Gnulib:
errno of 0 like failure, although POSIX
requires that the message declare it as a success, on some platforms:
FreeBSD 8.2, OpenBSD 4.7, Mac OS X 10.5.
strerror buffer on some platforms:
Cygwin 1.7.9.
Portability problems not fixed by Gnulib:
ferror) on write failure, but not all platforms do this:
glibc 2.13, cygwin 1.7.9.
Next: poll, Previous: perror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pipePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pipe.html
Gnulib module: pipe-posix
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
EMFILE if no
resources are left on some platforms:
Cygwin 1.7.9.
Next: popen, Previous: pipe, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/poll.html
Gnulib module: poll
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
poll replacement can only be called on descriptors
created by the socket function, not on regular file descriptors.
poll replacement might
return 0 even before the timeout has passed. Programs using it with pipes can
thus busy wait.
Next: posix_fadvise, Previous: poll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
popenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/popen.html
Gnulib module: popen
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
COMSPEC is not set.
popen calls into subsequent popen children:
Cygwin 1.5.x.
Next: posix_fallocate, Previous: popen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_fadvisePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_fadvise.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly across the entire data range of files larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: posix_madvise, Previous: posix_fadvise, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_fallocatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_fallocate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly across the entire data range of files larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: posix_mem_offset, Previous: posix_fallocate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_madvisePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_madvise.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_memalign, Previous: posix_madvise, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_mem_offsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_mem_offset.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_openpt, Previous: posix_mem_offset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_memalignPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_memalign.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
The Gnulib module pagealign_alloc provides a similar API
that returns memory aligned on a system page boundary.
Next: posix_spawn, Previous: posix_memalign, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_openptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_openpt.html
Gnulib module: posix_openpt
Portability problems fixed by Gnulib:
ENOSYS or ENOENT on
some platforms.
Portability problems not fixed by Gnulib:
Note that when using this function to open the master side of a
pseudo-terminal, you still need platform dependent code to open the
corresponding slave side. The Gnulib module openpty provides
an easy-to-use API that does both at once.
Next: posix_spawn_file_actions_addclose, Previous: posix_openpt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn.html
Gnulib module: posix_spawn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawn_file_actions_adddup2, Previous: posix_spawn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawn_file_actions_addclosePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn_file_actions_addclose.html
Gnulib module: posix_spawn_file_actions_addclose
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawn_file_actions_addopen, Previous: posix_spawn_file_actions_addclose, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawn_file_actions_adddup2POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn_file_actions_adddup2.html
Gnulib module: posix_spawn_file_actions_adddup2
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawn_file_actions_destroy, Previous: posix_spawn_file_actions_adddup2, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawn_file_actions_addopenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn_file_actions_addopen.html
Gnulib module: posix_spawn_file_actions_addopen
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawn_file_actions_init, Previous: posix_spawn_file_actions_addopen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawn_file_actions_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn_file_actions_destroy.html
Gnulib module: posix_spawn_file_actions_destroy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_destroy, Previous: posix_spawn_file_actions_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawn_file_actions_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawn_file_actions_init.html
Gnulib module: posix_spawn_file_actions_init
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getflags, Previous: posix_spawn_file_actions_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_destroy.html
Gnulib module: posix_spawnattr_destroy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getpgroup, Previous: posix_spawnattr_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getflagsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getflags.html
Gnulib module: posix_spawnattr_getflags
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getschedparam, Previous: posix_spawnattr_getflags, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getpgroupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getpgroup.html
Gnulib module: posix_spawnattr_getpgroup
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getschedpolicy, Previous: posix_spawnattr_getpgroup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getschedparam.html
Gnulib module: posix_spawnattr_getschedparam
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getsigdefault, Previous: posix_spawnattr_getschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getschedpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getschedpolicy.html
Gnulib module: posix_spawnattr_getschedpolicy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_getsigmask, Previous: posix_spawnattr_getschedpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getsigdefaultPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getsigdefault.html
Gnulib module: posix_spawnattr_getsigdefault
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_init, Previous: posix_spawnattr_getsigdefault, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_getsigmaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_getsigmask.html
Gnulib module: posix_spawnattr_getsigmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setflags, Previous: posix_spawnattr_getsigmask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_init.html
Gnulib module: posix_spawnattr_init
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setpgroup, Previous: posix_spawnattr_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setflagsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setflags.html
Gnulib module: posix_spawnattr_setflags
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setschedparam, Previous: posix_spawnattr_setflags, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setpgroupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setpgroup.html
Gnulib module: posix_spawnattr_setpgroup
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setschedpolicy, Previous: posix_spawnattr_setpgroup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setschedparam.html
Gnulib module: posix_spawnattr_setschedparam
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setsigdefault, Previous: posix_spawnattr_setschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setschedpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setschedpolicy.html
Gnulib module: posix_spawnattr_setschedpolicy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnattr_setsigmask, Previous: posix_spawnattr_setschedpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setsigdefaultPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setsigdefault.html
Gnulib module: posix_spawnattr_setsigdefault
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_spawnp, Previous: posix_spawnattr_setsigdefault, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnattr_setsigmaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnattr_setsigmask.html
Gnulib module: posix_spawnattr_setsigmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_destroy, Previous: posix_spawnattr_setsigmask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_spawnpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_spawnp.html
Gnulib module: posix_spawnp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getclockres, Previous: posix_spawnp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getcreatetime, Previous: posix_trace_attr_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getclockresPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getclockres.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getgenversion, Previous: posix_trace_attr_getclockres, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getcreatetimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getcreatetime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getinherited, Previous: posix_trace_attr_getcreatetime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getgenversionPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getgenversion.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getlogfullpolicy, Previous: posix_trace_attr_getgenversion, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getinheritedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getinherited.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getlogsize, Previous: posix_trace_attr_getinherited, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getlogfullpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getlogfullpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getmaxdatasize, Previous: posix_trace_attr_getlogfullpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getlogsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getlogsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getmaxsystemeventsize, Previous: posix_trace_attr_getlogsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getmaxdatasizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getmaxdatasize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getmaxusereventsize, Previous: posix_trace_attr_getmaxdatasize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getmaxsystemeventsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getmaxsystemeventsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getname, Previous: posix_trace_attr_getmaxsystemeventsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getmaxusereventsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getmaxusereventsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getstreamfullpolicy, Previous: posix_trace_attr_getmaxusereventsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getnamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_getstreamsize, Previous: posix_trace_attr_getname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getstreamfullpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getstreamfullpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_init, Previous: posix_trace_attr_getstreamfullpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_getstreamsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_getstreamsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setinherited, Previous: posix_trace_attr_getstreamsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setlogfullpolicy, Previous: posix_trace_attr_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setinheritedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setinherited.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setlogsize, Previous: posix_trace_attr_setinherited, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setlogfullpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setlogfullpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setmaxdatasize, Previous: posix_trace_attr_setlogfullpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setlogsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setlogsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setname, Previous: posix_trace_attr_setlogsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setmaxdatasizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setmaxdatasize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setstreamfullpolicy, Previous: posix_trace_attr_setmaxdatasize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setnamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_attr_setstreamsize, Previous: posix_trace_attr_setname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setstreamfullpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setstreamfullpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_clear, Previous: posix_trace_attr_setstreamfullpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_attr_setstreamsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_attr_setstreamsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_close, Previous: posix_trace_attr_setstreamsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_clearPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_clear.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_create, Previous: posix_trace_clear, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_close.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_create_withlog, Previous: posix_trace_close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_createPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_create.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_event, Previous: posix_trace_create, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_create_withlogPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_create_withlog.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventid_equal, Previous: posix_trace_create_withlog, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_event.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventid_get_name, Previous: posix_trace_event, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventid_equalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventid_equal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventid_open, Previous: posix_trace_eventid_equal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventid_get_namePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventid_get_name.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventset_add, Previous: posix_trace_eventid_get_name, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventid_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventid_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventset_del, Previous: posix_trace_eventid_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventset_addPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventset_add.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventset_empty, Previous: posix_trace_eventset_add, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventset_delPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventset_del.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventset_fill, Previous: posix_trace_eventset_del, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventset_emptyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventset_empty.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventset_ismember, Previous: posix_trace_eventset_empty, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventset_fillPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventset_fill.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventtypelist_getnext_id, Previous: posix_trace_eventset_fill, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventset_ismemberPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventset_ismember.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_eventtypelist_rewind, Previous: posix_trace_eventset_ismember, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventtypelist_getnext_idPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventtypelist_getnext_id.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_flush, Previous: posix_trace_eventtypelist_getnext_id, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_eventtypelist_rewindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_eventtypelist_rewind.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_get_attr, Previous: posix_trace_eventtypelist_rewind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_flushPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_flush.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_get_filter, Previous: posix_trace_flush, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_get_attrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_get_attr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_get_status, Previous: posix_trace_get_attr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_get_filterPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_get_filter.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_getnext_event, Previous: posix_trace_get_filter, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_get_statusPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_get_status.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_open, Previous: posix_trace_get_status, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_getnext_eventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_getnext_event.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_rewind, Previous: posix_trace_getnext_event, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_set_filter, Previous: posix_trace_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_rewindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_rewind.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_shutdown, Previous: posix_trace_rewind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_set_filterPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_set_filter.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_start, Previous: posix_trace_set_filter, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_shutdownPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_shutdown.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_stop, Previous: posix_trace_shutdown, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_startPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_start.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_timedgetnext_event, Previous: posix_trace_start, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_stopPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_stop.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_trid_eventid_open, Previous: posix_trace_stop, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_timedgetnext_eventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_timedgetnext_event.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_trace_trygetnext_event, Previous: posix_trace_timedgetnext_event, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_trid_eventid_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_trid_eventid_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_typed_mem_get_info, Previous: posix_trace_trid_eventid_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_trace_trygetnext_eventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_trace_trygetnext_event.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: posix_typed_mem_open, Previous: posix_trace_trygetnext_event, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_typed_mem_get_infoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_typed_mem_get_info.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pow, Previous: posix_typed_mem_get_info, Up: ISO C and POSIX Function Substitutes [Contents][Index]
posix_typed_mem_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/posix_typed_mem_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: powf, Previous: posix_typed_mem_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
powPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pow.html
Gnulib module: pow
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: powl, Previous: pow, Up: ISO C and POSIX Function Substitutes [Contents][Index]
powfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/powf.html
Gnulib module: powf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pread, Previous: powf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
powlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/powl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: printf, Previous: powl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
preadPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pread.html
Gnulib module: pread
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
Next: pselect, Previous: pread, Up: ISO C and POSIX Function Substitutes [Contents][Index]
printfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/printf.html
Gnulib module: printf-posix or stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module printf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or printf-posix, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or printf-posix, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EOF but
does not set the error flag for ferror on some platforms:
glibc 2.13, cygwin 1.7.9.
Next: psiginfo, Previous: printf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pselectPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pselect.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: psignal, Previous: pselect, Up: ISO C and POSIX Function Substitutes [Contents][Index]
psiginfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/psiginfo.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_atfork, Previous: psiginfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
psignalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/psignal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_destroy, Previous: psignal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_atforkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_atfork.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getdetachstate, Previous: pthread_atfork, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getguardsize, Previous: pthread_attr_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getdetachstatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getdetachstate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getinheritsched, Previous: pthread_attr_getdetachstate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getguardsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getguardsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getschedparam, Previous: pthread_attr_getguardsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getinheritschedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getinheritsched.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getschedpolicy, Previous: pthread_attr_getinheritsched, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getschedparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getscope, Previous: pthread_attr_getschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getschedpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getschedpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getstack, Previous: pthread_attr_getschedpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getscopePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getscope.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getstacksize, Previous: pthread_attr_getscope, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getstackPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getstack.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_init, Previous: pthread_attr_getstack, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_getstacksizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_getstacksize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setdetachstate, Previous: pthread_attr_getstacksize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setguardsize, Previous: pthread_attr_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setdetachstatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setdetachstate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setinheritsched, Previous: pthread_attr_setdetachstate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setguardsizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setguardsize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setschedparam, Previous: pthread_attr_setguardsize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setinheritschedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setinheritsched.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setschedpolicy, Previous: pthread_attr_setinheritsched, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setschedparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setscope, Previous: pthread_attr_setschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setschedpolicyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setschedpolicy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setstack, Previous: pthread_attr_setschedpolicy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setscopePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setscope.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_setstacksize, Previous: pthread_attr_setscope, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setstackPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setstack.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrier_destroy, Previous: pthread_attr_setstack, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_attr_setstacksizePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_attr_setstacksize.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrier_init, Previous: pthread_attr_setstacksize, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_barrier_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_barrier_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrier_wait, Previous: pthread_barrier_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_barrier_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_barrier_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrierattr_destroy, Previous: pthread_barrier_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_barrier_waitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_barrier_wait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrierattr_getpshared, Previous: pthread_barrier_wait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_barrierattr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_barrierattr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_barrierattr_setpshared, Previous: pthread_barrierattr_getpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_barrierattr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_barrierattr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cleanup_pop, Previous: pthread_barrierattr_setpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cancelPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cancel.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cleanup_push, Previous: pthread_cancel, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cleanup_popPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cleanup_pop.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_broadcast, Previous: pthread_cleanup_pop, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cleanup_pushPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cleanup_push.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_destroy, Previous: pthread_cleanup_push, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_broadcastPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_broadcast.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_init, Previous: pthread_cond_broadcast, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_signal, Previous: pthread_cond_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_timedwait, Previous: pthread_cond_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_signalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_signal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_cond_wait, Previous: pthread_cond_signal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_timedwaitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_timedwait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_condattr_destroy, Previous: pthread_cond_timedwait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_cond_waitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_cond_wait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_condattr_getclock, Previous: pthread_cond_wait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_condattr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_condattr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_condattr_getpshared, Previous: pthread_condattr_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_condattr_getclockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_condattr_getclock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_condattr_setclock, Previous: pthread_condattr_getpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_condattr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_condattr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_condattr_setpshared, Previous: pthread_condattr_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_condattr_setclockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_condattr_setclock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_detach, Previous: pthread_condattr_setpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_createPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_create.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_equal, Previous: pthread_create, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_detachPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_detach.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_exit, Previous: pthread_detach, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_equalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_equal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getconcurrency, Previous: pthread_equal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_exitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_exit.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getcpuclockid, Previous: pthread_exit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_getconcurrencyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_getconcurrency.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getschedparam, Previous: pthread_getconcurrency, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_getcpuclockidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_getcpuclockid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getspecific, Previous: pthread_getcpuclockid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_getschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_getschedparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_join, Previous: pthread_getschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_getspecificPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_getspecific.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_key_create, Previous: pthread_getspecific, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_joinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_join.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_key_delete, Previous: pthread_join, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_key_createPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_key_create.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_kill, Previous: pthread_key_create, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_key_deletePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_key_delete.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_consistent, Previous: pthread_key_delete, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_killPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_kill.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_destroy, Previous: pthread_kill, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_consistentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_consistent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_getprioceiling, Previous: pthread_mutex_consistent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_init, Previous: pthread_mutex_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_getprioceilingPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_getprioceiling.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_lock, Previous: pthread_mutex_getprioceiling, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_setprioceiling, Previous: pthread_mutex_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_lockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_lock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_timedlock, Previous: pthread_mutex_lock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_setprioceilingPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_setprioceiling.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_trylock, Previous: pthread_mutex_setprioceiling, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_timedlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_timedlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_unlock, Previous: pthread_mutex_timedlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_trylockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_trylock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_destroy, Previous: pthread_mutex_trylock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutex_unlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutex_unlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_getprioceiling, Previous: pthread_mutex_unlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_getprotocol, Previous: pthread_mutexattr_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_getprioceilingPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_getprioceiling.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_getpshared, Previous: pthread_mutexattr_getprioceiling, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_getprotocolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_getprotocol.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_gettype, Previous: pthread_mutexattr_getpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_getrobustPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_getrobust.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_init, Previous: pthread_mutexattr_getrobust, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_gettypePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_gettype.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_setprioceiling, Previous: pthread_mutexattr_gettype, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_setprotocol, Previous: pthread_mutexattr_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_setprioceilingPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_setprioceiling.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_setpshared, Previous: pthread_mutexattr_setprioceiling, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_setprotocolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_setprotocol.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_settype, Previous: pthread_mutexattr_setpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_setrobustPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_setrobust.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_once, Previous: pthread_mutexattr_setrobust, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_mutexattr_settypePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_mutexattr_settype.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_destroy, Previous: pthread_mutexattr_settype, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_oncePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_once.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_init, Previous: pthread_once, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_rdlock, Previous: pthread_rwlock_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_timedrdlock, Previous: pthread_rwlock_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_rdlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_rdlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
gl_rwlock_t type from the Gnulib
module ‘lock’.
Next: pthread_rwlock_timedwrlock, Previous: pthread_rwlock_rdlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_timedrdlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_timedrdlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_tryrdlock, Previous: pthread_rwlock_timedrdlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_timedwrlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_timedwrlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_trywrlock, Previous: pthread_rwlock_timedwrlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_tryrdlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_tryrdlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_unlock, Previous: pthread_rwlock_tryrdlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_trywrlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_trywrlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlock_wrlock, Previous: pthread_rwlock_trywrlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_unlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_unlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlockattr_destroy, Previous: pthread_rwlock_unlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlock_wrlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlock_wrlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlockattr_getpshared, Previous: pthread_rwlock_wrlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlockattr_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlockattr_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_rwlockattr_setpshared, Previous: pthread_rwlockattr_getpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_rwlockattr_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_rwlockattr_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setcancelstate, Previous: pthread_rwlockattr_setpshared, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_selfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_self.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setcanceltype, Previous: pthread_self, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setcancelstatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setcancelstate.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setconcurrency, Previous: pthread_setcancelstate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setcanceltypePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setcanceltype.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setschedparam, Previous: pthread_setcanceltype, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setconcurrencyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setconcurrency.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setschedprio, Previous: pthread_setconcurrency, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setschedparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setschedparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setspecific, Previous: pthread_setschedparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setschedprioPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setschedprio.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_sigmask, Previous: pthread_setschedprio, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_setspecificPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_setspecific.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_spin_destroy, Previous: pthread_setspecific, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_sigmaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_sigmask.html
Gnulib module: pthread_sigmask
Portability problems fixed by Gnulib:
<pthread.h> instead of <signal.h>
on some platforms:
Mac OS X 10.3, FreeBSD 6.4, OpenBSD 3.8, OSF/1 4.0, Solaris 2.6.
-lpthread on some platforms:
FreeBSD 6.4, HP-UX 11.31, Solaris 9.
Portability problems not fixed by Gnulib:
Next: pthread_spin_init, Previous: pthread_sigmask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_spin_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_spin_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_spin_lock, Previous: pthread_spin_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_spin_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_spin_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_spin_trylock, Previous: pthread_spin_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_spin_lockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_spin_lock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_spin_unlock, Previous: pthread_spin_lock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_spin_trylockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_spin_trylock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_testcancel, Previous: pthread_spin_trylock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_spin_unlockPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_spin_unlock.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ptsname, Previous: pthread_spin_unlock, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pthread_testcancelPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pthread_testcancel.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putc, Previous: pthread_testcancel, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ptsnamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ptsname.html
Gnulib module: ptsname
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note that the Gnulib module ptsname_r is a version of this
function that is more likely to be thread-safe.
Next: putc_unlocked, Previous: ptsname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putc.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: putchar, Previous: putc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putc_unlockedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putc_unlocked.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: putchar_unlocked, Previous: putc_unlocked, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putcharPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putchar.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: putenv, Previous: putchar, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putchar_unlockedPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putchar_unlocked.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: putmsg, Previous: putchar_unlocked, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putenv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Extension: Gnulib provides a module ‘putenv’ that substitutes a
putenv implementation that can also be used to remove environment
variables.
Next: putpmsg, Previous: putenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: puts, Previous: putmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putpmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putpmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pututxline, Previous: putpmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/puts.html
Gnulib module: stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: putwc, Previous: puts, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pututxlinePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pututxline.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putwchar, Previous: pututxline, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putwcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putwc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: pwrite, Previous: putwc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
putwcharPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/putwchar.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: qsort, Previous: putwchar, Up: ISO C and POSIX Function Substitutes [Contents][Index]
pwritePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/pwrite.html
Gnulib module: pwrite
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
off_t argument
when large file support is enabled on some platforms:
HP-UX 11.11.
Portability problems not fixed by Gnulib:
Next: quick_exit, Previous: pwrite, Up: ISO C and POSIX Function Substitutes [Contents][Index]
qsortPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/qsort.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: raise, Previous: qsort, Up: ISO C and POSIX Function Substitutes [Contents][Index]
quick_exitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rand, Previous: quick_exit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
raisePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/raise.html
Gnulib module: raise
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rand_r, Previous: raise, Up: ISO C and POSIX Function Substitutes [Contents][Index]
randPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rand.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: random, Previous: rand, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rand_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rand_r.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: read, Previous: rand_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
randomPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/random.html
Gnulib module: random
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: readdir, Previous: random, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/read.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EINTR, even in programs that don’t
install any signal handlers, on some platforms:
Mac OS X 10.5.
For handling EINTR, Gnulib provides a module ‘safe-read’ with a
function safe_read.
Next: readdir_r, Previous: read, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/readdir.html
Gnulib module: readdir
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. Also, on platforms
where ino_t is a 32-bit type, this function may report inode numbers
incorrectly. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
d_ino values, some
older systems are rumored to return d_ino values equal to zero
for directory entries that do not really exist. Although Gnulib
formerly attempted to cater to these older systems, this caused
misbehavior on standard systems and so Gnulib does not attempt to
cater to them any more. If you know of any problems caused by this,
please send a bug report.
Next: readlink, Previous: readdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readdir_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/readdir_r.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
readdir.
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. Also, on platforms
where ino_t is a 32-bit type, this function may report inode numbers
incorrectly. The fix is to use the AC_SYS_LARGEFILE macro.
Next: readlinkat, Previous: readdir_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/readlink.html
Gnulib module: readlink
Portability problems fixed by Gnulib:
readlink("link/",buf,len):
FreeBSD 7.2, Solaris 9, Mac OS X 10.10.
readlink returns int instead of
ssize_t:
glibc 2.4, FreeBSD 6.0, OpenBSD 3.8, Cygwin 1.5.x, AIX 7.1.
Portability problems not fixed by Gnulib:
readlink is called on a directory: In the case of NFS mounted
directories, Cygwin sets errno to ENOENT or EIO instead of
EINVAL. To avoid this problem, check for a directory before calling
readlink.
readlink is called on a file that is not a symbolic link:
Irix may set errno to ENXIO instead of EINVAL. Cygwin
may set errno to EACCES instead of EINVAL.
errno to ERANGE rather than returning truncated
contents, and Linux sets errno to EINVAL if the
requested length is zero. Use the gnulib module areadlink for
improved ability to read symlink contents.
Next: readv, Previous: readlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readlinkatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/readlinkat.html
Gnulib module: readlinkat
Portability problems fixed by Gnulib:
readlink("link/",buf,len):
Mac OS X 10.10.
readlinkat returns int instead of
ssize_t:
AIX 7.1.
Portability problems not fixed by Gnulib:
readlink is called on a directory: In the case of NFS mounted
directories, Cygwin sets errno to ENOENT or EIO instead of
EINVAL. To avoid this problem, check for a directory before calling
readlink.
readlink is called on a file that is not a symbolic link:
Irix may set errno to ENXIO instead of EINVAL. Cygwin
may set errno to EACCES instead of EINVAL.
errno to ERANGE rather than returning truncated
contents, and Linux sets errno to EINVAL if the
requested length is zero. Use the gnulib module areadlink for
improved ability to read symlink contents.
Next: realloc, Previous: readlinkat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
readvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/readv.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: realpath, Previous: readv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
reallocPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/realloc.html
Gnulib module: realloc-posix
Portability problems fixed by Gnulib:
errno to ENOMEM on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
realloc with a size of 0. With a
NULL pointer argument, this is the same ambiguity as malloc (0)
on whether a unique zero-size object is created. With a non-NULL
pointer argument, C99 requires that if realloc (p, 0) returns
NULL then p is still valid. Among implementations that
obey C99, behavior varies on whether realloc (p, 0) always
fails and leaves p valid, or usually succeeds and returns a
unique zero-size object; either way, a program not suspecting these
semantics will leak memory (either the still-valid p, or the
non-NULL return value). Meanwhile, several implementations violate
C99, by always calling free (p) but returning NULL:
glibc, Cygwin
Extension: Gnulib provides a module ‘realloc-gnu’ that substitutes a
realloc implementation that behaves more like the glibc implementation.
Next: recv, Previous: realloc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
realpathPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/realpath.html
Gnulib module: canonicalize-lgpl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: recvfrom, Previous: realpath, Up: ISO C and POSIX Function Substitutes [Contents][Index]
recvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/recv.html
Gnulib module: recv
Portability problems fixed by Gnulib:
int instead of ssize_t
on some platforms:
OSF/1 5.1.
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: recvmsg, Previous: recv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
recvfromPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/recvfrom.html
Gnulib module: recvfrom
Portability problems fixed by Gnulib:
int instead of ssize_t
on some platforms:
OSF/1 5.1.
errno, and WSAGetLastError must be used
instead.
_HPUX_ALT_XOPEN_SOCKET_API
is not defined, this function behaves incorrectly because it is declared
to take a pointer to a 64-bit wide socklen_t entity but in fact
considers it as a pointer to a 32-bit wide unsigned int entity.
Portability problems not fixed by Gnulib:
socklen_t type; in this case this function’s
sixth argument type is ‘int *’.
Next: regcomp, Previous: recvfrom, Up: ISO C and POSIX Function Substitutes [Contents][Index]
recvmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/recvmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: regerror, Previous: recvmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
regcompPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/regcomp.html
Gnulib module: regex
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: regexec, Previous: regcomp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
regerrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/regerror.html
Gnulib module: regex
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: regfree, Previous: regerror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
regexecPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/regexec.html
Gnulib module: regex
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: remainder, Previous: regexec, Up: ISO C and POSIX Function Substitutes [Contents][Index]
regfreePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/regfree.html
Gnulib module: regex
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: remainderf, Previous: regfree, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remainderPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remainder.html
Gnulib module: remainder or remainder-ieee
Portability problems fixed by either Gnulib module remainder or remainder-ieee:
Portability problems fixed by Gnulib module remainder-ieee:
Portability problems not fixed by Gnulib:
Next: remainderl, Previous: remainder, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remainderfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remainderf.html
Gnulib module: remainderf or remainderf-ieee
Portability problems fixed by either Gnulib module remainderf or remainderf-ieee:
Portability problems fixed by Gnulib module remainderf-ieee:
Portability problems not fixed by Gnulib:
Next: remove, Previous: remainderf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remainderlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remainderl.html
Gnulib module: remainderl or remainderl-ieee
Portability problems fixed by either Gnulib module remainderl or remainderl-ieee:
Portability problems fixed by Gnulib module remainderl-ieee:
Portability problems not fixed by Gnulib:
Next: remque, Previous: remainderl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
removePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remove.html
Gnulib module: remove
Portability problems fixed by Gnulib:
remove("dir/./") on some platforms:
Cygwin 1.5.x.
Portability problems not fixed by Gnulib:
Next: remquo, Previous: remove, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remquePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remque.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: remquof, Previous: remque, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remquoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remquo.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: remquol, Previous: remquo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remquofPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remquof.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rename, Previous: remquof, Up: ISO C and POSIX Function Substitutes [Contents][Index]
remquolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/remquol.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: renameat, Previous: remquol, Up: ISO C and POSIX Function Substitutes [Contents][Index]
renamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rename.html
Gnulib module: rename
Portability problems fixed by Gnulib:
rename("dir","new/"):
NetBSD 1.6.
rename("file","new/"):
AIX 7.1, Solaris 11.3, Cygwin 1.5.x, mingw, MSVC 14.
rename("link-to-file/","f"):
FreeBSD 7.2.
rename("link/","new") corrupts link:
Solaris 9.
Portability problems not fixed by Gnulib:
rename("symlink-to-dir/","dir2") rename
dir and leave symlink-to-dir dangling; likewise, it
requires that rename("dir","dangling/") rename dir so
that dangling is no longer a dangling symlink. This behavior
is counter-intuitive, so on some systems, rename fails with
ENOTDIR if either argument is a symlink with a trailing slash:
glibc, OpenBSD, Cygwin 1.7.
rename do nothing and return 0 if the
source and destination are hard links to the same file. This behavior
is counterintuitive, and on some systems renameat is a no-op in
this way only if the source and destination identify the same
directory entry. On these systems, for example, although renaming
./f to f is a no-op, renaming f to g
deletes f when f and g are hard links to the same
file:
NetBSD 7.0.
stat function
for 30 seconds after the rename, on NFS file systems, on some platforms:
Linux 2.6.18.
Next: rewind, Previous: rename, Up: ISO C and POSIX Function Substitutes [Contents][Index]
renameatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/renameat.html
Gnulib module: renameat
Portability problems fixed by Gnulib:
renameat(fd,"file",fd,"new/"):
Solaris 11.3.
renameat(fd,"link/",fd,"new") corrupts link:
Solaris 9.
<unistd.h> instead of <stdio.h>
on some platforms:
NetBSD 7.0, Solaris 11.3.
Portability problems not fixed by Gnulib:
renameat(fd,"symlink-to-dir/",fd,"dir2") rename
dir and leave symlink-to-dir dangling; likewise, it
requires that renameat(fd,"dir",fd,"dangling/") rename dir so
that dangling is no longer a dangling symlink. This behavior
is counter-intuitive, so on some systems, renameat fails with
ENOTDIR if either argument is a symlink with a trailing slash:
glibc, OpenBSD, Cygwin 1.7.
renameat do nothing and return 0 if the
source and destination are hard links to the same file. This behavior
is counterintuitive, and on some systems renameat is a no-op in
this way only if the source and destination identify the same
directory entry. On these systems, for example, although renaming
./f to f is a no-op, renaming f to g
deletes f when f and g are hard links to the same
file:
NetBSD 7.0.
stat function
for 30 seconds after the rename, on NFS file systems, on some platforms:
Linux 2.6.18.
Next: rewinddir, Previous: renameat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rewindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rewind.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
Next: rint, Previous: rewind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rewinddirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rewinddir.html
Gnulib module: rewinddir
Portability problems fixed by Gnulib:
long int is a 32-bit type, this function may
not work correctly on huge directories larger than 2 GB.
(Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
Next: rintf, Previous: rewinddir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rintPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rint.html
Gnulib module: rint
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rintl, Previous: rint, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rintf.html
Gnulib module: rintf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rmdir, Previous: rintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rintlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rintl.html
Gnulib module: rintl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: round, Previous: rintl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
rmdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/rmdir.html
Gnulib module: rmdir
Portability problems fixed by Gnulib:
<io.h> or
<direct.h>) on some platforms:
mingw, MSVC 14.
rmdir("dir/./") on some platforms:
Cygwin 1.5.x.
EINVAL instead of the expected
ENOTDIR for rmdir("file/") on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
rmdir fails because the specified directory is not empty, the
errno value is system dependent.
rmdir("link-to-empty/") remove empty
and leave link-to-empty as a dangling symlink. This is
counter-intuitive, so some systems fail with ENOTDIR instead:
glibc
Next: roundf, Previous: rmdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
roundPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/round.html
Gnulib module: round or round-ieee
Portability problems fixed by either Gnulib module round or round-ieee:
Portability problems fixed by Gnulib module round-ieee:
Portability problems not fixed by Gnulib:
Next: roundl, Previous: round, Up: ISO C and POSIX Function Substitutes [Contents][Index]
roundfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/roundf.html
Gnulib module: roundf or roundf-ieee
Portability problems fixed by either Gnulib module roundf or roundf-ieee:
Portability problems fixed by Gnulib module roundf-ieee:
Portability problems not fixed by Gnulib:
Next: scalbln, Previous: roundf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
roundlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/roundl.html
Gnulib module: roundl or roundl-ieee
Portability problems fixed by either Gnulib module roundl or roundl-ieee:
Portability problems fixed by Gnulib module roundl-ieee:
Portability problems not fixed by Gnulib:
Next: scalblnf, Previous: roundl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalblnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalbln.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalblnl, Previous: scalbln, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalblnfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalblnf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalbn, Previous: scalblnf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalblnlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalblnl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalbnf, Previous: scalblnl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalbnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalbn.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalbnl, Previous: scalbn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalbnfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalbnf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scandir, Previous: scalbnf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scalbnlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scalbnl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scanf, Previous: scalbnl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scandirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scandir.html
Gnulib module: scandir
Portability problems fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. Also, on platforms
where ino_t is a 32-bit type, this function may report inode numbers
incorrectly. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
int (*) (const void *, const void *) on some platforms:
glibc 2.3.6, Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8, Interix 3.5.
int (*) (void *, void *) on some platforms:
AIX 5.1.
Next: sched_get_priority_max, Previous: scandir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
scanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/scanf.html
Gnulib module: stdio, nonblocking
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
feof would return nonzero. However, on some systems this
function attempts to read from the underlying file descriptor even if
the stream’s end-of-file indicator is set. These systems include
glibc and default Solaris.
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: sched_get_priority_min, Previous: scanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_get_priority_maxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_get_priority_max.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_getparam, Previous: sched_get_priority_max, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_get_priority_minPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_get_priority_min.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_getscheduler, Previous: sched_get_priority_min, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_getparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_getparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_rr_get_interval, Previous: sched_getparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_getschedulerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_getscheduler.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_setparam, Previous: sched_getscheduler, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_rr_get_intervalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_rr_get_interval.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_setscheduler, Previous: sched_rr_get_interval, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_setparamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_setparam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_yield, Previous: sched_setparam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_setschedulerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_setscheduler.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: seed48, Previous: sched_setscheduler, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sched_yieldPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sched_yield.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: seekdir, Previous: sched_yield, Up: ISO C and POSIX Function Substitutes [Contents][Index]
seed48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/seed48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: select, Previous: seed48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
seekdirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/seekdir.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
long int is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. The fix is to use
the AC_SYS_LARGEFILE macro (only on Mac OS X systems).
Next: sem_close, Previous: seekdir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
selectPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/select.html
Gnulib module: select
Portability problems fixed by Gnulib:
select can only be
called on descriptors created by the socket function, not on regular
file descriptors.
errno, and WSAGetLastError must be used
instead.
nfds argument is 0 on some platforms:
Interix 3.5.
Portability problems not fixed by Gnulib:
select with a timeout, some implementations modify the
timeout parameter so that upon return from the function, it contains the
amount of time not slept. Other implementations leave the timeout parameter
unmodified.
select can only be called on descriptors created by the
socket function, not on regular file descriptors.
select replacement might
return 0 even before the timeout has passed. Programs using it with pipes can
thus busy wait.
select applied to a file descriptor opened
for reading and associated with /dev/null hangs, waiting for input,
when instead it should return immediately.
select
may fail, setting errno to EBADF.
<unistd.h>, not <sys/select.h>,
on some platforms:
IRIX 5.3.
Next: sem_destroy, Previous: select, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_closePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_close.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_getvalue, Previous: sem_close, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_destroyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_destroy.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_init, Previous: sem_destroy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_getvaluePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_getvalue.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_open, Previous: sem_getvalue, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_initPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_init.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_post, Previous: sem_init, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_timedwait, Previous: sem_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_postPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_post.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_trywait, Previous: sem_post, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_timedwaitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_timedwait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_unlink, Previous: sem_timedwait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_trywaitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_trywait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sem_wait, Previous: sem_trywait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_unlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_unlink.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: semctl, Previous: sem_unlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sem_waitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sem_wait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: semget, Previous: sem_wait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
semctlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/semctl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: semop, Previous: semctl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
semgetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/semget.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: send, Previous: semget, Up: ISO C and POSIX Function Substitutes [Contents][Index]
semopPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/semop.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sendmsg, Previous: semop, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sendPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/send.html
Gnulib module: send
Portability problems fixed by Gnulib:
int instead of ssize_t
on some platforms:
OSF/1 5.1.
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: sendto, Previous: send, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sendmsgPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sendmsg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setbuf, Previous: sendmsg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sendtoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sendto.html
Gnulib module: sendto
Portability problems fixed by Gnulib:
int instead of ssize_t
on some platforms:
OSF/1 5.1.
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: setegid, Previous: sendto, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setbufPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setbuf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setenv, Previous: setbuf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setegidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setegid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: seteuid, Previous: setegid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setenv.html
Gnulib module: setenv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
setenv(NULL,"",0) gracefully
fail with EINVAL, but not all implementations guarantee this,
and the requirement was removed.
Next: setgid, Previous: setenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
seteuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/seteuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setgrent, Previous: seteuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setgidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setgid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sethostent, Previous: setgid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setgrentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setgrent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setitimer, Previous: setgrent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sethostentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sethostent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setjmp, Previous: sethostent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setitimerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setitimer.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setkey, Previous: setitimer, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
setjmp saves the signal mask in the
jmp_buf. It does on BSD platforms, and on glibc platforms when
_BSD_SOURCE (and/or _DEFAULT_SOURCE on glibc >= 2.19) is defined;
in this case setjmp behaves like sigsetjmp(.,1), and functions
_setjmp and _longjmp are available that don’t save or restore
the signal mask. On System V platforms (excluding HP-UX), and on glibc
platforms by default, setjmp doesn’t save the signal mask.
Next: setlocale, Previous: setjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setkeyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setkey.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
<stdlib.h>
(without -D_GNU_SOURCE) on some platforms:
glibc (at least 2.11–2.13).
Next: setlogmask, Previous: setkey, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setlocalePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setlocale.html
Gnulib module: setlocale
Portability problems fixed by Gnulib:
setlocale(category,NULL)
ignores the environment variables LC_ALL, category, and
LANG.
setlocale(LC_ALL,name) succeeds and sets the LC_CTYPE category to
‘C’ when it does not support the encoding, instead of failing.
setlocale understands different
locale names, that are not based on ISO 639 language names and ISO 3166 country
names.
Portability problems not fixed by Gnulib:
setlocale(LC_ALL,NULL) always returns "C".
setlocale(LC_ALL,"") will only update categories that
are deemed appropriate for the LC_ALL environment value, even if
there are other categories set to different values in the environment.
In addition any value is accepted for LC_CTYPE, and so NULL
is never returned to indicate a failure to set locale.
To verify category values, each category must be set individually
with setlocale(LC_COLLATE,"") etc.
Next: setnetent, Previous: setlocale, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setlogmaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setlogmask.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setpgid, Previous: setlogmask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setnetentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setnetent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setpgrp, Previous: setnetent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setpgidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setpgid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setpriority, Previous: setpgid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setpgrpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setpgrp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setprotoent, Previous: setpgrp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setpriorityPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setpriority.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setpwent, Previous: setpriority, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setprotoentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setprotoent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setregid, Previous: setprotoent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setpwentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setpwent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setreuid, Previous: setpwent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setregidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setregid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setrlimit, Previous: setregid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setreuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setreuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setservent, Previous: setreuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setrlimitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setrlimit.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
rlim_t is a 32-bit type, this function does not
allow to set limits larger than 4 GB, such as for RLIMIT_FSIZE. The fix is
to use the AC_SYS_LARGEFILE macro.
Next: setsid, Previous: setrlimit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setserventPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setservent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setsockopt, Previous: setservent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setsidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setsid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setstate, Previous: setsid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setsockoptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setsockopt.html
Gnulib module: setsockopt
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: setuid, Previous: setsockopt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setstatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setstate.html
Gnulib module: random
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setutxent, Previous: setstate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setuidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setuid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setvbuf, Previous: setuid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setutxentPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setutxent.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: shm_open, Previous: setutxent, Up: ISO C and POSIX Function Substitutes [Contents][Index]
setvbufPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/setvbuf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
Next: shm_unlink, Previous: setvbuf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shm_openPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shm_open.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: shmat, Previous: shm_open, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shm_unlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shm_unlink.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: shmctl, Previous: shm_unlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shmatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shmat.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
shmat into a previously malloc-ed region fail on SunOS 4,
with errno set to EINVAL, even if there is an munmap call
in between.
SHM_REMAP is needed in order to force shmat
to replace existing memory mappings in the specify address range. On other
platforms, it is not needed.
Next: shmdt, Previous: shmat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shmctlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shmctl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: shmget, Previous: shmctl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shmdtPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shmdt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: shutdown, Previous: shmdt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shmgetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shmget.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
shmget requires superuser privileges.
Next: sigaction, Previous: shmget, Up: ISO C and POSIX Function Substitutes [Contents][Index]
shutdownPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/shutdown.html
Gnulib module: shutdown
Portability problems fixed by Gnulib:
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
Next: sigaddset, Previous: shutdown, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigactionPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigaction.html
Gnulib module: sigaction
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
SIG_IGN for the SIGCHLD signal is equivalent
to a signal handler
void handle_child (int sigchld)
{
while (waitpid (-1, NULL, WNOHANG) > 0)
;
}
except that SIG_IGN for SIGCHLD has the effect that the children
execution times are not accounted in the times function.
On some platforms (BSD? SystemV? Linux?), you need to use the sigaction
flag SA_NOCLDWAIT in order to obtain this behavior.
Next: sigaltstack, Previous: sigaction, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigaddsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigaddset.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigdelset, Previous: sigaddset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigaltstackPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigaltstack.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sigaltstack doesn’t work on HP-UX 11/IA-64 and OpenBSD
3.6/Sparc64.
ss_sp member of stack_t as
the upper bound instead of the lower bound of the alternate stack on
some platforms:
Irix 6.5
Next: sigemptyset, Previous: sigaltstack, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigdelsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigdelset.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigfillset, Previous: sigdelset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigemptysetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigemptyset.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sighold, Previous: sigemptyset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigfillsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigfillset.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigignore, Previous: sigfillset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigholdPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sighold.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: siginterrupt, Previous: sighold, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigignorePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigignore.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigismember, Previous: sigignore, Up: ISO C and POSIX Function Substitutes [Contents][Index]
siginterruptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/siginterrupt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: POSIX recommends using sigaction with SA_RESTART instead of
siginterrupt (sig, 0).
Next: siglongjmp, Previous: siginterrupt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigismemberPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigismember.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: signal, Previous: sigismember, Up: ISO C and POSIX Function Substitutes [Contents][Index]
siglongjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/siglongjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: signbit, Previous: siglongjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
signalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/signal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sigaction instead of
signal.
Next: signgam, Previous: signal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
signbitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/signbit.html
Gnulib module: signbit
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigpause, Previous: signbit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
signgamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/signgam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigpending, Previous: signgam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigpausePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigpause.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigprocmask, Previous: sigpause, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigpendingPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigpending.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigqueue, Previous: sigpending, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigprocmaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigprocmask.html
Gnulib module: sigprocmask
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigrelse, Previous: sigprocmask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigqueuePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigqueue.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigset, Previous: sigqueue, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigrelsePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigrelse.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigsetjmp, Previous: sigrelse, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigset.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigsuspend, Previous: sigset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigsetjmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigsetjmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigtimedwait, Previous: sigsetjmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigsuspendPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigsuspend.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigwait, Previous: sigsuspend, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigtimedwaitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigtimedwait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sigwaitinfo
does; other platforms may not do the same.
Next: sigwaitinfo, Previous: sigtimedwait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigwaitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigwait.html
Gnulib module: extensions
Portability problems fixed by Gnulib:
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: sin, Previous: sigwait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sigwaitinfoPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sigwaitinfo.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sinf, Previous: sigwaitinfo, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sin.html
Gnulib module: sin
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sinh, Previous: sin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sinf.html
Gnulib module: sinf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sinhf, Previous: sinf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sinh.html
Gnulib module: sinh
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sinhl, Previous: sinh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sinhf.html
Gnulib module: sinhf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sinl, Previous: sinhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sinhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sleep, Previous: sinhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sinlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sinl.html
Gnulib module: sinl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: snprintf, Previous: sinl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sleepPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sleep.html
Gnulib module: sleep
Portability problems fixed by Gnulib:
void on some
platforms:
mingw (2005 and older).
Portability problems not fixed by Gnulib:
sleep function may interfere with the program’s
use of the SIGALRM signal. On Linux, it doesn’t; on other platforms,
it may.
Next: sockatmark, Previous: sleep, Up: ISO C and POSIX Function Substitutes [Contents][Index]
snprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/snprintf.html
Gnulib module: snprintf or snprintf-posix
Portability problems fixed by either Gnulib module snprintf or snprintf-posix:
"%2$s", on some platforms:
NetBSD 3.0, mingw, BeOS.
Portability problems fixed by Gnulib module snprintf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: socket, Previous: snprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sockatmarkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sockatmark.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: socketpair, Previous: sockatmark, Up: ISO C and POSIX Function Substitutes [Contents][Index]
socketPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/socket.html
Gnulib module: socket
Portability problems fixed by Gnulib:
socket function cannot be used in calls to read,
write, and close; you have to use recv, send,
closesocket in these cases instead.
errno, and WSAGetLastError must be used
instead.
Portability problems not fixed by Gnulib:
socket function cannot be used
in calls to read, write, and close; you have to use
recv, send, closesocket in these cases instead.
Next: sprintf, Previous: socket, Up: ISO C and POSIX Function Substitutes [Contents][Index]
socketpairPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/socketpair.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sqrt, Previous: socketpair, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sprintf.html
Gnulib module: sprintf-posix
Portability problems fixed by Gnulib:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: sqrtf, Previous: sprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sqrtPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sqrt.html
Gnulib module: sqrt
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sqrtl, Previous: sqrt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sqrtfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sqrtf.html
Gnulib module: sqrtf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: srand, Previous: sqrtf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sqrtlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sqrtl.html
Gnulib module: sqrtl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: srand48, Previous: sqrtl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
srandPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/srand.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: srandom, Previous: srand, Up: ISO C and POSIX Function Substitutes [Contents][Index]
srand48POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/srand48.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sscanf, Previous: srand48, Up: ISO C and POSIX Function Substitutes [Contents][Index]
srandomPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/srandom.html
Gnulib module: random
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: stat, Previous: srandom, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: statvfs, Previous: sscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
statPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stat.html
Gnulib module: stat
Portability problems fixed by Gnulib:
off_t is a 32-bit type, stat may not correctly
report the size of files or block devices larger than 2 GB.
(Cf. AC_SYS_LARGEFILE.)
st_atime, st_ctime, st_mtime fields are affected by
the current time zone and by the DST flag of the current time zone on some
platforms:
mingw, MSVC 14 (when the environment variable TZ is set).
ENOENT
on files such as ‘C:\pagefile.sys’ and
on directories such as ‘C:\System Volume Information’.
stat("link-to-file/",buf) succeeds instead
of failing with ENOTDIR.
FreeBSD 7.2, AIX 7.1, Solaris 9, mingw64.
stat(".",buf) and stat("./",buf) give
different results:
mingw, MSVC 14.
tv_sec value, tv_nsec might be in the range
-1000000000..-1, representing a negative nanoseconds
offset from tv_sec.
Portability problems not fixed by Gnulib:
struct stat.
stat function sometimes sets errno to EACCES when
ENOENT would be more appropriate.
struct stat, it is not possible to
portably replace stat via an object-like macro. Therefore,
expressions such as (islnk ? lstat : stat) (name, buf) are not
portable, and should instead be written islnk ? lstat (name,
buf) : stat (name, buf).
Next: stderr, Previous: stat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
statvfsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/statvfs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
f_blocks in ‘struct statvfs’ is a 32-bit
value, this function may not work correctly on files systems larger than
4 TiB. The fix is to use the AC_SYS_LARGEFILE macro. This affects
glibc/Hurd, HP-UX 11, Solaris.
Gnulib provides a module fsusage that provides similar information
as statvfs.
Next: stdin, Previous: statvfs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
stderrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stderr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
stderr
can affect an unrelated file that happened to be assigned to fd 2.
The gnulib *-safer modules may be used to guarantee that fd 2 stays
reserved for stderr.
Next: stdout, Previous: stderr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
stdinPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stdin.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
stdin
can affect an unrelated file that happened to be assigned to fd 0.
The gnulib *-safer modules may be used to guarantee that fd 0 stays
reserved for stdin.
Next: stpcpy, Previous: stdin, Up: ISO C and POSIX Function Substitutes [Contents][Index]
stdoutPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stdout.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
stdout
can affect an unrelated file that happened to be assigned to fd 1.
The gnulib *-safer modules may be used to guarantee that fd 1 stays
reserved for stdout.
Next: stpncpy, Previous: stdout, Up: ISO C and POSIX Function Substitutes [Contents][Index]
stpcpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stpcpy.html
Gnulib module: stpcpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcasecmp, Previous: stpcpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
stpncpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/stpncpy.html
Gnulib module: stpncpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcasecmp_l, Previous: stpncpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcasecmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcasecmp.html
Gnulib module: strcase
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbscasecmp that does a case
insensitive comparison of character strings and that works in all locales.
Next: strcat, Previous: strcasecmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcasecmp_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcasecmp_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strchr, Previous: strcasecmp_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcat.html
Gnulib module: string
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcmp, Previous: strcat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strchrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strchr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbschr that works on
character strings in all locales.
Next: strcoll, Previous: strchr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcoll_l, Previous: strcmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcoll.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno to EILSEQ, on Solaris 10, in
UTF-8 locales, when at least one of the strings contains a Unicode character
in a block that was not assigned in Unicode 4.0.
Next: strcpy, Previous: strcoll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcoll_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcoll_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcspn, Previous: strcoll_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcpy.html
Gnulib module: string
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: strcpy (dst, src) is only safe to use when you can guarantee that
there are at least strlen (src) + 1 bytes allocated at dst.
Next: strdup, Previous: strcpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strcspnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strcspn.html
Gnulib module: strcspn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbscspn that works on character
strings in all locales.
Next: strerror, Previous: strcspn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strdupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strdup.html
Gnulib module: strdup or strdup-posix
Portability problems fixed by either Gnulib module strdup or strdup-posix:
<string.h> on some old platforms.
Portability problems fixed by Gnulib module strdup-posix:
errno to ENOMEM on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: strerror_l, Previous: strdup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strerrorPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strerror.html
Gnulib module: strerror
Portability problems fixed by Gnulib:
strerror(0) (by setting
errno or using a string similar to out-of-range values),
although POSIX requires this to leave errno unchanged and
report success, on some platforms:
FreeBSD 8.2, OpenBSD 4.7, Mac OS X 10.5.
strerror without setting and testing
errno.)
Portability problems not fixed by Gnulib:
Next: strerror_r, Previous: strerror, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strerror_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strerror_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strfmon, Previous: strerror_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strerror_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strerror_r.html
Gnulib module: strerror_r-posix
Portability problems fixed by Gnulib:
char *s = (strerror_r (err, buf, buflen) == 0 ? buf : NULL);
is essentially equivalent to this code using the glibc function:
char *s = strerror_r (err, buf, buflen);
strerror buffer on some platforms:
Cygwin 1.7.9.
<string.h> on some platforms:
glibc 2.8, OSF/1 5.1.
int instead of size_t on some
platforms:
AIX 5.1, OSF/1 5.1.
errno, instead of
returning the error number, on some platforms:
glibc 2.12 with -D_POSIX_C_SOURCE=200112L, AIX 6.1, OSF/1 5.1.
errno, on some platforms:
Solaris 10.
<errno.h> on
some platforms:
MSVC 14.
strerror_r(0, buf, len),
although POSIX requires this to succeed, on some platforms:
FreeBSD 8.2.
0 than
strerror on some platforms:
Mac OS X 10.5.
Portability problems not fixed by Gnulib:
Next: strfmon_l, Previous: strerror_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strfmonPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strfmon.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strftime, Previous: strfmon, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strfmon_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strfmon_l.html
Gnulib module: strfmon_l
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strftime_l, Previous: strfmon_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strftimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strftime.html
Gnulib module: strftime-fixes
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
Portability problems not fixed by Gnulib:
tzset.
Extension: Gnulib offers a module ‘nstrftime’ that provides an
nstrftime function with various GNU extensions.
Next: strlen, Previous: strftime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strftime_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strftime_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strncasecmp, Previous: strftime_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strlenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strlen.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strncasecmp_l, Previous: strlen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strncasecmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strncasecmp.html
Gnulib module: strcase
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbsncasecmp and mbspcasecmp
that do a case insensitive comparison of character strings and that work in all
locales.
Next: strncat, Previous: strncasecmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strncasecmp_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strncasecmp_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strncmp, Previous: strncasecmp_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strncatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strncat.html
Gnulib module: strncat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strncpy, Previous: strncat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strncmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strncmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strndup, Previous: strncmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strncpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strncpy.html
Gnulib module: string
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Note: This function was designed for the use-case of filling a fixed-size record with a string, before writing it to a file. This function is not appropriate for copying a string into a bounded memory area, because you have no guarantee that the result will be NUL-terminated. Even if you add the NUL byte at the end yourself, this function is inefficient (as it spends time clearing unused memory) and will allow silent truncation to occur, which is not a good behavior for GNU programs. For more details, see https://meyering.net/crusade-to-eliminate-strncpy/.
Next: strnlen, Previous: strncpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strndupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strndup.html
Gnulib module: strndup
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strpbrk, Previous: strndup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strnlenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strnlen.html
Gnulib module: strnlen
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strptime, Previous: strnlen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strpbrkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strpbrk.html
Gnulib module: strpbrk
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbspbrk that works on character
strings in all locales.
Next: strrchr, Previous: strpbrk, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strptimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strptime.html
Gnulib module: strptime
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strsignal, Previous: strptime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strrchrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strrchr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbsrchr that works
on character strings in all locales.
Next: strspn, Previous: strrchr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strsignalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strsignal.html
Gnulib module: strsignal
Portability problems fixed by Gnulib:
unistd.h instead of
string.h on some platforms:
NetBSD 5.0.
Portability problems not fixed by Gnulib:
const char * instead of char * on
some platforms:
cygwin 1.5.25.
Next: strstr, Previous: strsignal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strspnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strspn.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbsspn that works on character
strings in all locales.
Next: strtod, Previous: strspn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strstrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strstr.html
Gnulib module: strstr or strstr-simple
Portability problems fixed by either Gnulib module strstr-simple
or strstr:
Portability problems fixed by Gnulib strstr:
Portability problems not fixed by Gnulib:
mbsstr that works
on character strings in all locales.
Next: strtof, Previous: strstr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtod.html
Gnulib module: strtod or strtod-obsolete
Portability problems fixed by either Gnulib module strtod or strtod-obsolete:
Portability problems fixed by Gnulib module strtod-obsolete:
Portability problems not fixed by Gnulib:
Next: strtoimax, Previous: strtod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtofPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtof.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtok, Previous: strtof, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtoimaxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtoimax.html
Gnulib module: strtoimax
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtok_r, Previous: strtoimax, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtokPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtok.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtol, Previous: strtok, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtok_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtok_r.html
Gnulib module: strtok_r
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mbstok_r that works on character
strings in all locales.
Next: strtold, Previous: strtok_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtol.html
Gnulib module: strtol
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoll, Previous: strtol, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtoldPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtold.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoul, Previous: strtold, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtoll.html
Gnulib module: strtoll
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoull, Previous: strtoll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtoulPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtoul.html
Gnulib module: strtoul
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoumax, Previous: strtoul, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtoullPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtoull.html
Gnulib module: strtoull
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strxfrm, Previous: strtoull, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strtoumaxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strtoumax.html
Gnulib module: strtoumax
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strxfrm_l, Previous: strtoumax, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strxfrmPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strxfrm.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: swab, Previous: strxfrm, Up: ISO C and POSIX Function Substitutes [Contents][Index]
strxfrm_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/strxfrm_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: swprintf, Previous: strxfrm_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
swabPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/swab.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: swscanf, Previous: swab, Up: ISO C and POSIX Function Substitutes [Contents][Index]
swprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/swprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: symlink, Previous: swprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
swscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/swscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: symlinkat, Previous: swscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
symlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/symlink.html
Gnulib module: symlink
Portability problems fixed by Gnulib:
symlink(value,"name/") mistakenly creates a
symlink:
FreeBSD 7.2, AIX 7.1, Solaris 9.
EPERM:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: sync, Previous: symlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
symlinkatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/symlinkat.html
Gnulib module: symlinkat
Portability problems fixed by Gnulib:
stdio.h instead of
unistd.h:
Cygwin 1.7.1.
symlinkat(value, fd, "name/") mistakenly creates a
symlink:
AIX 7.1.
Portability problems not fixed by Gnulib:
Next: sysconf, Previous: symlinkat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
syncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sync.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: syslog, Previous: sync, Up: ISO C and POSIX Function Substitutes [Contents][Index]
sysconfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/sysconf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: system, Previous: sysconf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
syslogPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/syslog.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tan, Previous: syslog, Up: ISO C and POSIX Function Substitutes [Contents][Index]
systemPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/system.html
Gnulib module: system-posix
Portability problems fixed by Gnulib:
WIFSIGNALED, WIFEXITED, WIFSTOPPED,
WTERMSIG, WEXITSTATUS, WNOHANG, WUNTRACED,
WSTOPSIG are not defined in <stdlib.h> (only in
<sys/wait.h>) on some platforms:
MirBSD 10.
Portability problems not fixed by Gnulib:
system function is cmd.exe, not /bin/sh. Accordingly,
the rules for quoting shell arguments containing spaces, quote or other special
characters are different.
Next: tanf, Previous: system, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tan.html
Gnulib module: tan
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tanh, Previous: tan, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tanf.html
Gnulib module: tanf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tanhf, Previous: tanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanhPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tanh.html
Gnulib module: tanh
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tanhl, Previous: tanh, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanhfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tanhf.html
Gnulib module: tanhf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tanl, Previous: tanhf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanhlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tanhl.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcdrain, Previous: tanhl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tanlPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tanl.html
Gnulib module: tanl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcflow, Previous: tanl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcdrainPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcdrain.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tcdrain on a non-tty fails with errno set to
EINVAL or, on Mac OS X, also EOPNOTSUPP or ENODEV, rather
than ENOTTY.
Next: tcflush, Previous: tcdrain, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcflowPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcflow.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcgetattr, Previous: tcflow, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcflushPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcflush.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tcflush of TCIFLUSH on a non-tty fails with
errno set to EINVAL rather than ENOTTY.
tcflush of TCOFLUSH on a non-tty fails with
errno set to EINVAL or, on IRIX, also ENOSYS, or, on Mac OS X,
also EOPNOTSUPP or ENODEV, rather than ENOTTY.
Next: tcgetpgrp, Previous: tcflush, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcgetattrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcgetattr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcgetsid, Previous: tcgetattr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcgetpgrpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcgetpgrp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcsendbreak, Previous: tcgetpgrp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcgetsidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcgetsid.html
Gnulib module: tcgetsid
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcsetattr, Previous: tcgetsid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcsendbreakPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcsendbreak.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tcsetpgrp, Previous: tcsendbreak, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcsetattrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcsetattr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tdelete, Previous: tcsetattr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tcsetpgrpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tcsetpgrp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: telldir, Previous: tcsetpgrp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tdeletePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tdelete.html
Gnulib module: tsearch
Portability problems fixed by Gnulib:
tdelete returns NULL when removing the last element of a tree
on some platforms:
OpenBSD 4.0.
Portability problems not fixed by Gnulib:
Next: tempnam, Previous: tdelete, Up: ISO C and POSIX Function Substitutes [Contents][Index]
telldirPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/telldir.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
long int is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. The fix is to use
the AC_SYS_LARGEFILE macro (only on Mac OS X systems).
Next: tfind, Previous: telldir, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tempnamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tempnam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mkstemp instead.
Next: tgamma, Previous: tempnam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tfindPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tfind.html
Gnulib module: tsearch
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tgammaf, Previous: tfind, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tgammaPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tgamma.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tgammal, Previous: tgamma, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tgammafPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tgammaf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: time, Previous: tgammaf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tgammalPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tgammal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timer_create, Previous: tgammal, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/time.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timer_delete, Previous: time, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timer_createPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timer_create.html
Gnulib module: timer-time
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
ENOSYS on some platforms:
OpenBSD 4.9.
Next: timer_getoverrun, Previous: timer_create, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timer_deletePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timer_delete.html
Gnulib module: timer-time
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
ENOSYS on some platforms:
OpenBSD 4.9.
Next: timer_gettime, Previous: timer_delete, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timer_getoverrunPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timer_getoverrun.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timer_settime, Previous: timer_getoverrun, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timer_gettimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timer_gettime.html
Gnulib module: timer-time
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
ENOSYS on some platforms:
OpenBSD 4.9.
Next: times, Previous: timer_gettime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timer_settimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timer_settime.html
Gnulib module: timer-time
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
ENOSYS on some platforms:
OpenBSD 4.9.
Next: timezone, Previous: timer_settime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timesPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/times.html
Gnulib module: times
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tms_cutime and tms_cstime will always be
0 when the module is used.
Next: tmpfile, Previous: times, Up: ISO C and POSIX Function Substitutes [Contents][Index]
timezonePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/timezone.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tzset.
A more portable way of getting the UTC offset is to use
strftime with the %z format. See strftime.
Next: tmpnam, Previous: timezone, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tmpfilePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tmpfile.html
Gnulib module: tmpfile
Portability problems fixed by Gnulib:
off_t is a 32-bit type, tmpfile may not work
correctly to create files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
Next: toascii, Previous: tmpfile, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tmpnamPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tmpnam.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mkstemp instead.
Next: tolower, Previous: tmpnam, Up: ISO C and POSIX Function Substitutes [Contents][Index]
toasciiPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/toascii.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tolower_l, Previous: toascii, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tolowerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tolower.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: toupper, Previous: tolower, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tolower_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tolower_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: toupper_l, Previous: tolower_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
toupperPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/toupper.html
Gnulib module: ctype
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: towctrans, Previous: toupper, Up: ISO C and POSIX Function Substitutes [Contents][Index]
toupper_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/toupper_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: towctrans_l, Previous: toupper_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towctransPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towctrans.html
Gnulib module: towctrans
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: towlower, Previous: towctrans, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towctrans_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towctrans_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: towlower_l, Previous: towctrans_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towlowerPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towlower.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: towupper, Previous: towlower, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towlower_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towlower_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: towupper_l, Previous: towlower_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towupperPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towupper.html
Gnulib module: wctype-h
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: trunc, Previous: towupper, Up: ISO C and POSIX Function Substitutes [Contents][Index]
towupper_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/towupper_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: truncate, Previous: towupper_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
truncPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/trunc.html
Gnulib module: trunc or trunc-ieee
Portability problems fixed by either Gnulib module trunc or trunc-ieee:
-D_GNU_SOURCE) on some platforms:
glibc 2.8.
Portability problems fixed by Gnulib module trunc-ieee:
Portability problems not fixed by Gnulib:
Next: truncf, Previous: trunc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
truncatePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/truncate.html
Gnulib module: truncate
Portability problems fixed by Gnulib:
AC_SYS_LARGEFILE in effect.
off_t is a 32-bit type, this function is not
applicable to arbitrary lengths for files larger than 2 GB. The fix is to
use the AC_SYS_LARGEFILE macro.
Portability problems not fixed by Gnulib:
Next: truncl, Previous: truncate, Up: ISO C and POSIX Function Substitutes [Contents][Index]
truncfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/truncf.html
Gnulib module: truncf or truncf-ieee
Portability problems fixed by either Gnulib module truncf or truncf-ieee:
-D_GNU_SOURCE) on some platforms:
glibc 2.8.
Portability problems fixed by Gnulib module truncf-ieee:
Portability problems not fixed by Gnulib:
Next: tsearch, Previous: truncf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
trunclPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/truncl.html
Gnulib module: truncl or truncl-ieee
Portability problems fixed by either Gnulib module truncl or truncl-ieee:
-D_GNU_SOURCE) on some platforms:
glibc 2.8.
Portability problems fixed by Gnulib module truncl-ieee:
Portability problems not fixed by Gnulib:
Next: ttyname, Previous: truncl, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tsearchPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tsearch.html
Gnulib module: tsearch
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ttyname_r, Previous: tsearch, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ttynamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ttyname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: twalk, Previous: ttyname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ttyname_rPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ttyname_r.html
Gnulib module: ttyname_r
Portability problems fixed by Gnulib:
_REENTRANT is defined,
on some platforms:
HP-UX 11.
_POSIX_PTHREAD_SEMANTICS is not defined).
Portability problems not fixed by Gnulib:
Next: tzname, Previous: ttyname_r, Up: ISO C and POSIX Function Substitutes [Contents][Index]
twalkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/twalk.html
Gnulib module: tsearch
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tzset, Previous: twalk, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tznamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tzname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
tzset.
A more portable way of getting the time zone abbreviation is to use
strftime with the %Z format. See strftime.
Next: ulimit, Previous: tzname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
tzsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/tzset.html
Gnulib module: tzset
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
Portability problems not fixed by Gnulib:
TZ environment variable,
consisting of a time zone abbreviation containing exactly three ASCII
letters with no daylight saving time or angle brackets, and with no
support for tz database settings like
TZ='America/New_York'. Even this subset does not work on
applications built via the Universal Windows Platform, as it does not
make environment variables like TZ available to applications.
TZ values,
as this feature was added in IEEE Std 1003.1-2001.
Next: umask, Previous: tzset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ulimitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ulimit.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: uname, Previous: ulimit, Up: ISO C and POSIX Function Substitutes [Contents][Index]
umaskPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/umask.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ungetc, Previous: umask, Up: ISO C and POSIX Function Substitutes [Contents][Index]
unamePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/uname.html
Gnulib module: uname
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ungetwc, Previous: uname, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ungetcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ungetc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
Next: unlink, Previous: ungetc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ungetwcPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/ungetwc.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: unlinkat, Previous: ungetwc, Up: ISO C and POSIX Function Substitutes [Contents][Index]
unlinkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/unlink.html
Gnulib module: unlink
Portability problems fixed by Gnulib:
unlink("link-to-file/"):
GNU/Hurd, FreeBSD 7.2, AIX 7.1, Solaris 9.
unlink("..") succeeds
without doing anything.
Portability problems not fixed by Gnulib:
EPERM. Meanwhile, if a process
has the ability to unlink directories, POSIX requires that
unlink("symlink-to-dir/") remove dir and leave
symlink-to-dir dangling; this behavior is counter-intuitive.
The gnulib module unlinkdir can help determine whether code must be
cautious of unlinking directories.
Next: unlockpt, Previous: unlink, Up: ISO C and POSIX Function Substitutes [Contents][Index]
unlinkatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/unlinkat.html
Gnulib module: unlinkat
Portability problems fixed by Gnulib:
unlinkat(fd, "..", 0) succeeds
without doing anything.
unlinkat(fd,"file/",flag):
GNU/Hurd, Solaris 9.
fcntl.h instead of
unistd.h:
Cygwin 1.7.1.
Portability problems not fixed by Gnulib:
unlinkat(fd,name,AT_REMOVEDIR) fails because the specified
directory is not empty, the errno value is system dependent.
unlinkdir(fd,"link-to-empty/",AT_REMOVEDIR)
remove empty and leave link-to-empty as a dangling
symlink. This is counter-intuitive, so some systems fail with
ENOTDIR instead:
glibc
EPERM. Meanwhile, if a process
has the ability to unlink directories, POSIX requires that
unlinkat(fd,"symlink-to-dir/",0) remove dir and leave
symlink-to-dir dangling; this behavior is counter-intuitive.
The gnulib module unlinkdir can help determine whether code must be
cautious of unlinking directories.
Next: unsetenv, Previous: unlinkat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
unlockptPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/unlockpt.html
Gnulib module: unlockpt
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: uselocale, Previous: unlockpt, Up: ISO C and POSIX Function Substitutes [Contents][Index]
unsetenvPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/unsetenv.html
Gnulib module: unsetenv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
unsetenv(NULL) gracefully
fail with EINVAL, but not all implementations guarantee this,
and the requirement was removed.
Next: utime, Previous: unsetenv, Up: ISO C and POSIX Function Substitutes [Contents][Index]
uselocalePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/uselocale.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: utimensat, Previous: uselocale, Up: ISO C and POSIX Function Substitutes [Contents][Index]
utimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/utime.html
Gnulib module: utime
Portability problems fixed by Gnulib:
TZ is set).
utime omits const
for the second argument:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
utime (file, NULL) fails to set the
file’s timestamp to the current time.
utimensat(AT_FDCWD,file,times,0), or the gnulib module utimens,
instead.
Next: utimes, Previous: utime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
utimensatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/utimensat.html
Gnulib module: utimensat
Portability problems fixed by Gnulib:
ENOSYS on some platforms:
Linux kernel 2.6.21.
ENOSYS if passed the flag
AT_SYMLINK_NOFOLLOW on a regular file:
Linux kernel 2.6.22.
UTIME_OMIT or UTIME_NOW, some systems require
the tv_sec argument to be 0, and don’t necessarily handle all
file permissions in the manner required by POSIX:
Linux kernel 2.6.25.
UTIME_OMIT for the modification time, but specifying
an access time, some systems fail to update the change time:
Linux kernel 2.6.32, Solaris 11.1.
tv_nsec do not lead to a failure on some
platforms:
Linux kernel 2.6.22.19 on hppa.
Portability problems not fixed by Gnulib:
ENOSYS if passed the flag
AT_SYMLINK_NOFOLLOW on a symlink.
lstat modifies the access time of
symlinks on some platforms, so utimensat with
AT_SYMLINK_NOFOLLOW can only effectively change modification time:
Cygwin.
stat modifies the access time of
directories on some platforms, so utimensat can only
effectively change directory modification time:
Cygwin 1.5.x.
The gnulib module fdutimensat provides a similar interface.
Next: va_arg, Previous: utimensat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
utimesPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/utimes.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
const in the second argument
on some platforms:
OSF/1 5.1.
utimensat(AT_FDCWD,file,times,0), or the gnulib module utimens,
instead.
utimes (file, NULL) fails to set the
file’s timestamp to the current time:
glibc 2.3.3.
utimes failed on read-only files when
utime worked fine.
glibc 2.2.5.
Extension: Gnulib provides a module ‘utimens’ that works around these problems and allows to set the time with nanosecond resolution (as far as supported by the file system).
Next: va_copy, Previous: utimes, Up: ISO C and POSIX Function Substitutes [Contents][Index]
va_argPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/va_arg.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
va_arg must be a type that is invariant under
the “default argument promotions” (ISO C 99 6.5.2.2 paragraph 6). This
means that the following are not valid here:
Use ‘double’ instead.
Use ‘int’ instead.
Use ‘int’ or ‘unsigned int’ instead.
This is a portability problem because you don’t know the width of some
abstract types like uid_t, gid_t, mode_t. So, instead of
mode = va_arg (ap, mode_t);
you have to write
mode = (sizeof (mode_t) < sizeof (int)
? va_arg (ap, int)
: va_arg (ap, mode_t));
Next: va_end, Previous: va_arg, Up: ISO C and POSIX Function Substitutes [Contents][Index]
va_copyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/va_copy.html
Gnulib module: stdarg
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: va_start, Previous: va_copy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
va_endPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/va_end.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vdprintf, Previous: va_end, Up: ISO C and POSIX Function Substitutes [Contents][Index]
va_startPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/va_start.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vfprintf, Previous: va_start, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vdprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vdprintf.html
Gnulib module: vdprintf or vdprintf-posix
Portability problems fixed by either Gnulib module vdprintf or vdprintf-posix:
Portability problems fixed by Gnulib module vdprintf-posix:
hh, ll,
j, t, z) on some platforms:
BeOS.
"%2$s", on some platforms:
BeOS.
Portability problems not fixed by Gnulib:
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: vfscanf, Previous: vdprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vfprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vfprintf.html
Gnulib module: vfprintf-posix or stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module vfprintf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or vfprintf-posix, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or vfprintf-posix, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EOF but
does not set the error flag for ferror on some platforms:
glibc 2.13, cygwin 1.7.9.
Next: vfwprintf, Previous: vfprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vfscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vfscanf.html
Gnulib module: vfscanf, nonblocking
Portability problems fixed by Gnulib module vfscanf, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: vfwscanf, Previous: vfscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vfwprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vfwprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: vprintf, Previous: vfwprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vfwscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vfwscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: vscanf, Previous: vfwscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vprintf.html
Gnulib module: vprintf-posix or stdio, nonblocking, sigpipe
Portability problems fixed by Gnulib module vprintf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or vprintf-posix, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio or vprintf-posix, together with module sigpipe:
SIGPIPE handler, on some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EOF but
does not set the error flag for ferror on some platforms:
glibc 2.13, cygwin 1.7.9.
Next: vsnprintf, Previous: vprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vscanf.html
Gnulib module: vscanf, nonblocking
Portability problems fixed by Gnulib module vscanf, together with module nonblocking:
errno being set to EINVAL instead of EAGAIN on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: vsprintf, Previous: vscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vsnprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vsnprintf.html
Gnulib module: vsnprintf or vsnprintf-posix
Portability problems fixed by either Gnulib module vsnprintf or vsnprintf-posix:
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
Portability problems fixed by Gnulib module vsnprintf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: vsscanf, Previous: vsnprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vsprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vsprintf.html
Gnulib module: vsprintf-posix
Portability problems fixed by Gnulib:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: vswprintf, Previous: vsprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vsscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vsscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno
upon failure.
hh, ll, j,
t, z size specifiers.
Next: vswscanf, Previous: vsscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vswprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vswprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: vwprintf, Previous: vswprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vswscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vswscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: vwscanf, Previous: vswscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vwprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vwprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: wait, Previous: vwprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
vwscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/vwscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: waitid, Previous: vwscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
waitPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wait.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: waitpid, Previous: wait, Up: ISO C and POSIX Function Substitutes [Contents][Index]
waitidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/waitid.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
waitid with flag WNOWAIT
works correctly.
Next: wcpcpy, Previous: waitid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
waitpidPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/waitpid.html
Gnulib module: waitpid
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: wcpncpy, Previous: waitpid, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcpcpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcpcpy.html
Gnulib module: wcpcpy
Portability problems fixed by Gnulib:
-D_GNU_SOURCE) on some platforms:
glibc 2.13.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcrtomb, Previous: wcpcpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcpncpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcpncpy.html
Gnulib module: wcpncpy
Portability problems fixed by Gnulib:
-D_GNU_SOURCE) on some platforms:
glibc 2.13.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscasecmp, Previous: wcpncpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcrtombPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcrtomb.html
Gnulib module: wcrtomb
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscasecmp_l, Previous: wcrtomb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscasecmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscasecmp.html
Gnulib module: wcscasecmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscat, Previous: wcscasecmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscasecmp_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscasecmp_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcschr, Previous: wcscasecmp_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscat.html
Gnulib module: wcscat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscmp, Previous: wcscat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcschrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcschr.html
Gnulib module: wcschr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscoll, Previous: wcschr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscmp.html
Gnulib module: wcscmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscoll_l, Previous: wcscmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscoll.html
Gnulib module: wcscoll
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscpy, Previous: wcscoll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscoll_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscoll_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcscspn, Previous: wcscoll_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscpy.html
Gnulib module: wcscpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Note: wcscpy (dst, src) is only safe to use when you can guarantee that
there are at least wcslen (src) + 1 wide characters allocated at
dst.
Next: wcsdup, Previous: wcscpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcscspnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcscspn.html
Gnulib module: wcscspn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsftime, Previous: wcscspn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsdupPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsdup.html
Gnulib module: wcsdup
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcslen, Previous: wcsdup, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsftimePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsftime.html
Gnulib module: wcsftime
Portability problems fixed by Gnulib:
TZ has been set by Cygwin.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
tzset.
Next: wcsncasecmp, Previous: wcsftime, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcslenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcslen.html
Gnulib module: wcslen
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsncasecmp_l, Previous: wcslen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsncasecmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsncasecmp.html
Gnulib module: wcsncasecmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsncat, Previous: wcsncasecmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsncasecmp_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsncasecmp_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsncmp, Previous: wcsncasecmp_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsncatPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsncat.html
Gnulib module: wcsncat
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsncpy, Previous: wcsncat, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsncmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsncmp.html
Gnulib module: wcsncmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsnlen, Previous: wcsncmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsncpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsncpy.html
Gnulib module: wcsncpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore
cannot accommodate all Unicode characters.
Note: This function has no real use: It cannot be used for filling a fixed-size record with a wide string, before writing it to a file, because the wide string encoding is platform dependent and, on some platforms, also locale dependent. And this function is not appropriate for copying a wide string into a bounded memory area, because you have no guarantee that the result will be null-terminated. Even if you add the null character at the end yourself, this function is inefficient (as it spends time clearing unused memory) and will allow silent truncation to occur, which is not a good behavior for GNU programs.
Next: wcsnrtombs, Previous: wcsncpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsnlenPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsnlen.html
Gnulib module: wcsnlen
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcspbrk, Previous: wcsnlen, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsnrtombsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsnrtombs.html
Gnulib module: wcsnrtombs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsrchr, Previous: wcsnrtombs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcspbrkPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcspbrk.html
Gnulib module: wcspbrk
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsrtombs, Previous: wcspbrk, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsrchrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsrchr.html
Gnulib module: wcsrchr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsspn, Previous: wcsrchr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsrtombsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsrtombs.html
Gnulib module: wcsrtombs
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsstr, Previous: wcsrtombs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsspnPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsspn.html
Gnulib module: wcsspn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstod, Previous: wcsspn, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsstrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsstr.html
Gnulib module: wcsstr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstof, Previous: wcsstr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstodPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstod.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoimax, Previous: wcstod, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstofPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstof.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstok, Previous: wcstof, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstoimaxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstoimax.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstol, Previous: wcstoimax, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstokPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstok.html
Gnulib module: wcstok
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstold, Previous: wcstok, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstolPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstol.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoll, Previous: wcstol, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstoldPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstold.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstombs, Previous: wcstold, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstollPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstoll.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoul, Previous: wcstoll, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstombsPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstombs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoull, Previous: wcstombs, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstoulPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstoul.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoumax, Previous: wcstoul, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstoullPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstoull.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcswidth, Previous: wcstoull, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcstoumaxPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcstoumax.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsxfrm, Previous: wcstoumax, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcswidthPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcswidth.html
Gnulib module: wcswidth
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsxfrm_l, Previous: wcswidth, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsxfrmPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsxfrm.html
Gnulib module: wcsxfrm
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctob, Previous: wcsxfrm, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcsxfrm_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcsxfrm_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctomb, Previous: wcsxfrm_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctobPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctob.html
Gnulib module: wctob
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctrans, Previous: wctob, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctombPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctomb.html
Gnulib module: wctomb
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctrans_l, Previous: wctomb, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctransPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctrans.html
Gnulib module: wctrans
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctype, Previous: wctrans, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctrans_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctrans_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wctype_l, Previous: wctrans_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctypePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctype.html
Gnulib module: wctype
Portability problems fixed by Gnulib:
<wchar.h>, not in <wctype.h>, on
some platforms:
HP-UX 11.00.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcwidth, Previous: wctype, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wctype_lPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wctype_l.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmemchr, Previous: wctype_l, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wcwidthPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wcwidth.html
Gnulib module: wcwidth
Portability problems fixed by Gnulib:
-D_GNU_SOURCE) on some platforms:
glibc 2.8.
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmemcmp, Previous: wcwidth, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wmemchrPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wmemchr.html
Gnulib module: wmemchr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmemcpy, Previous: wmemchr, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wmemcmpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wmemcmp.html
Gnulib module: wmemcmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmemmove, Previous: wmemcmp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wmemcpyPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wmemcpy.html
Gnulib module: wmemcpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmemset, Previous: wmemcpy, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wmemmovePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wmemmove.html
Gnulib module: wmemmove
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wordexp, Previous: wmemmove, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wmemsetPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wmemset.html
Gnulib module: wmemset
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wordfree, Previous: wmemset, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wordexpPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wordexp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: wprintf, Previous: wordexp, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wordfreePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wordfree.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: write, Previous: wordfree, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wprintfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wprintf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
errno or the
stream error indicator on attempts to write to a read-only stream:
Cygwin 1.7.9.
Next: writev, Previous: wprintf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
writePOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/write.html
Gnulib module: write, nonblocking, sigpipe
Portability problems fixed by Gnulib module stdio, together with module nonblocking:
errno being set to ENOSPC instead of EAGAIN on some
platforms:
mingw, MSVC 14.
Portability problems fixed by Gnulib module stdio, together with module sigpipe:
EINVAL, instead of obeying the current SIGPIPE handler, on
some platforms:
mingw, MSVC 14.
Portability problems not fixed by Gnulib:
EINTR, even in programs that don’t
install any signal handlers, on some platforms:
Mac OS X 10.5.
For handling EINTR, Gnulib provides a module ‘safe-write’ with a
function safe_write.
Next: wscanf, Previous: write, Up: ISO C and POSIX Function Substitutes [Contents][Index]
writevPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/writev.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: y0, Previous: writev, Up: ISO C and POSIX Function Substitutes [Contents][Index]
wscanfPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/wscanf.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: y1, Previous: wscanf, Up: ISO C and POSIX Function Substitutes [Contents][Index]
y0POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/y0.html
Gnulib module: y0
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yn, Previous: y0, Up: ISO C and POSIX Function Substitutes [Contents][Index]
y1POSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/y1.html
Gnulib module: y1
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: y1, Up: ISO C and POSIX Function Substitutes [Contents][Index]
ynPOSIX specification:
http://www.opengroup.org/onlinepubs/9699919799/functions/yn.html
Gnulib module: yn
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Header File Substitutes, Previous: ISO C and POSIX Function Substitutes, Up: GNU Gnulib [Contents][Index]
This chapter describes which functions and function-like macros specified by older versions of POSIX are substituted by Gnulib, which portability pitfalls are fixed by Gnulib, and which (known) portability problems are not worked around by Gnulib.
The notation “Gnulib module: —” means that Gnulib does not provide a
module providing a substitute for the function. When the list
“Portability problems not fixed by Gnulib” is empty, such a module is
not needed: No portability problems are known. Otherwise, it indicates
that such a module would be useful but is not available: No one so far
found this function important enough to contribute a substitute for it.
If you need this particular function, you may write to
<bug-gnulib at gnu dot org>.
bcmpbcopybsd_signalbzeroecvtfcvtftimegcvtgetcontextgethostbyaddrgethostbynamegetwdh_errnoindexmakecontextmktemppthread_attr_getstackaddrpthread_attr_setstackaddrrindexscalbsetcontextswapcontextualarmusleepvforkwcswcs
Next: bcopy, Up: Past POSIX Function Substitutes [Contents][Index]
bcmpPOSIX specification: http://www.opengroup.org/susv3xsh/bcmp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
memcmp
instead.
Next: bsd_signal, Previous: bcmp, Up: Past POSIX Function Substitutes [Contents][Index]
bcopyPOSIX specification: http://www.opengroup.org/susv3xsh/bcopy.html
Gnulib module: bcopy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
memcpy
or memmove instead.
Next: bzero, Previous: bcopy, Up: Past POSIX Function Substitutes [Contents][Index]
bsd_signalPOSIX specification: http://www.opengroup.org/susv3xsh/bsd_signal.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ecvt, Previous: bsd_signal, Up: Past POSIX Function Substitutes [Contents][Index]
bzeroPOSIX specification: http://www.opengroup.org/susv3xsh/bzero.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
memset
instead.
Next: fcvt, Previous: bzero, Up: Past POSIX Function Substitutes [Contents][Index]
ecvtPOSIX specification: http://www.opengroup.org/susv3xsh/ecvt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sprintf
instead.
Next: ftime, Previous: ecvt, Up: Past POSIX Function Substitutes [Contents][Index]
fcvtPOSIX specification: http://www.opengroup.org/susv3xsh/fcvt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sprintf
instead.
Next: gcvt, Previous: fcvt, Up: Past POSIX Function Substitutes [Contents][Index]
ftimePOSIX specification: http://www.opengroup.org/susv3xsh/ftime.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
TZ has been set by Cygwin.
gettimeofday
or clock_gettime instead, and use ftime only as a fallback for
portability to Windows platforms.
Next: getcontext, Previous: ftime, Up: Past POSIX Function Substitutes [Contents][Index]
gcvtPOSIX specification: http://www.opengroup.org/susv3xsh/gcvt.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
sprintf
instead.
Next: gethostbyaddr, Previous: gcvt, Up: Past POSIX Function Substitutes [Contents][Index]
getcontextPOSIX specification: http://www.opengroup.org/susv3xsh/getcontext.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostbyname, Previous: getcontext, Up: Past POSIX Function Substitutes [Contents][Index]
gethostbyaddrPOSIX specification: http://www.opengroup.org/susv3xsh/gethostbyaddr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getwd, Previous: gethostbyaddr, Up: Past POSIX Function Substitutes [Contents][Index]
gethostbynamePOSIX specification: http://www.opengroup.org/susv3xsh/gethostbyname.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: h_errno, Previous: gethostbyname, Up: Past POSIX Function Substitutes [Contents][Index]
getwdPOSIX specification: http://www.opengroup.org/susv3xsh/getwd.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
getcwd function instead.
Next: index, Previous: getwd, Up: Past POSIX Function Substitutes [Contents][Index]
h_errnoPOSIX specification: http://www.opengroup.org/susv3xsh/h_errno.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: makecontext, Previous: h_errno, Up: Past POSIX Function Substitutes [Contents][Index]
indexPOSIX specification: http://www.opengroup.org/susv3xsh/index.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
strchr
instead.
Next: mktemp, Previous: index, Up: Past POSIX Function Substitutes [Contents][Index]
makecontextPOSIX specification: http://www.opengroup.org/susv3xsh/makecontext.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_attr_getstackaddr, Previous: makecontext, Up: Past POSIX Function Substitutes [Contents][Index]
mktempPOSIX specification: http://www.opengroup.org/susv3xsh/mktemp.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
mkstemp instead.
Next: pthread_attr_setstackaddr, Previous: mktemp, Up: Past POSIX Function Substitutes [Contents][Index]
pthread_attr_getstackaddrPOSIX specification: http://www.opengroup.org/susv3xsh/pthread_attr_getstackaddr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rindex, Previous: pthread_attr_getstackaddr, Up: Past POSIX Function Substitutes [Contents][Index]
pthread_attr_setstackaddrPOSIX specification: http://www.opengroup.org/susv3xsh/pthread_attr_setstackaddr.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalb, Previous: pthread_attr_setstackaddr, Up: Past POSIX Function Substitutes [Contents][Index]
rindexPOSIX specification: http://www.opengroup.org/susv3xsh/rindex.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
strrchr
instead.
Next: setcontext, Previous: rindex, Up: Past POSIX Function Substitutes [Contents][Index]
scalbPOSIX specification: http://www.opengroup.org/susv3xsh/scalb.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: swapcontext, Previous: scalb, Up: Past POSIX Function Substitutes [Contents][Index]
setcontextPOSIX specification: http://www.opengroup.org/susv3xsh/setcontext.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ualarm, Previous: setcontext, Up: Past POSIX Function Substitutes [Contents][Index]
swapcontextPOSIX specification: http://www.opengroup.org/susv3xsh/swapcontext.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: usleep, Previous: swapcontext, Up: Past POSIX Function Substitutes [Contents][Index]
ualarmPOSIX specification: http://www.opengroup.org/susv3xsh/ualarm.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vfork, Previous: ualarm, Up: Past POSIX Function Substitutes [Contents][Index]
usleepPOSIX specification: http://www.opengroup.org/susv3xsh/usleep.html
Gnulib module: usleep
Portability problems fixed by Gnulib:
usleep rejects attempts to sleep longer than 1
second, as allowed by POSIX:
mingw.
select or nanosleep if better resolution is needed:
IRIX 5.3, Solaris 2.4, older mingw, MSVC 14, BeOS.
Portability problems not fixed by Gnulib:
usleep function may interfere with the program’s
use of the SIGALRM signal. On Linux, it doesn’t; on other platforms,
it may.
Next: wcswcs, Previous: usleep, Up: Past POSIX Function Substitutes [Contents][Index]
vforkPOSIX specification: http://www.opengroup.org/susv3xsh/vfork.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: vfork, Up: Past POSIX Function Substitutes [Contents][Index]
wcswcsPOSIX specification: http://www.opengroup.org/susv3xsh/wcswcs.html
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
wcsstr
instead.
Next: Glibc Function Substitutes, Previous: Past POSIX Function Substitutes, Up: GNU Gnulib [Contents][Index]
This chapter describes which header files contained in GNU libc but not specified by ISO C or POSIX are substituted by Gnulib, which portability pitfalls are fixed by Gnulib, and which (known) portability problems are not worked around by Gnulib.
The notation “Gnulib module: —” means that Gnulib does not provide a
module providing a substitute for the header file. When the list
“Portability problems not fixed by Gnulib” is empty, such a module is
not needed: No portability problems are known. Otherwise, it indicates
that such a module would be useful but is not available: No one so far
found this header file important enough to contribute a substitute for it.
If you need this particular header file, you may write to
<bug-gnulib at gnu dot org>.
Next: aliases.h, Up: Glibc Header File Substitutes [Contents][Index]
Describes the structure of executables (and object files?) in the old
a.out format.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: alloca.h, Previous: a.out.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct aliasent and declares the functions
setaliasent, endaliasent,
getaliasent, getaliasent_r,
getaliasbyname, getaliasbyname_r.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ar.h, Previous: aliases.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the alloca function of function-like macro.
Documentation:
Gnulib module: alloca
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp.h, Previous: alloca.h, Up: Glibc Header File Substitutes [Contents][Index]
Describes the structure of files produced by the ‘ar’ program.
Defines the type struct ar_hdr and the macros ARMAG,
SARMAG, ARFMAG.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz.h, Previous: ar.h, Up: Glibc Header File Substitutes [Contents][Index]
Documentation:
Gnulib module: argp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: byteswap.h, Previous: argp.h, Up: Glibc Header File Substitutes [Contents][Index]
Documentation:
Gnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: crypt.h, Previous: argz.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the functions or function-like macros bswap_16, bswap_32,
bswap_64.
Gnulib module: byteswap
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endian.h, Previous: byteswap.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct crypt_data and declares the functions
crypt, crypt_r,
setkey, setkey_r,
encrypt, encrypt_r.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
crypt, setkey, encrypt are missing on some
platforms:
HP-UX 11, OSF/1 5.1.
struct crypt_data and the functions crypt_r,
setkey_r, encrypt_r are missing on some platforms:
IRIX 6.5, Solaris 11.3, Cygwin.
Next: envz.h, Previous: crypt.h, Up: Glibc Header File Substitutes [Contents][Index]
Describe’s the platform’s endianness (byte ordering of words stored in memory).
Defines the macros BYTE_ORDER, LITTLE_ENDIAN, BIG_ENDIAN,
PDP_ENDIAN.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: err.h, Previous: endian.h, Up: Glibc Header File Substitutes [Contents][Index]
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: error.h, Previous: envz.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the functions
warn, vwarn, warnx, vwarnx,
err, verr, errx, verrx.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execinfo.h, Previous: err.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the functions error, error_at_line and the variables
error_print_progname, error_message_count,
error_one_per_line.
Documentation:
Gnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fpu_control.h, Previous: error.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the functions backtrace, backtrace_symbols,
backtrace_symbols_fd.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fstab.h, Previous: execinfo.h, Up: Glibc Header File Substitutes [Contents][Index]
Handling of the FPU control word. Defines the fpu_control_t type,
declares the __fpu_control variable, and defines the _FPU_GETCW,
_FPU_SETCW macros.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fts.h, Previous: fpu_control.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct fstab, the macros FSTAB_*,
_PATH_FSTAB, and declares the functions
setfsent, endfsent,
getfsent, getfsspec, getfsfile.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
_PATH_FSTAB is missing on some platforms:
AIX 5.1, HP-UX 11.
Next: getopt.h, Previous: fstab.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the types FTS, FTSENT and the macros FTS_*,
and declares the functions fts_open, fts_read,
fts_children, fts_set, fts_close.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gshadow.h, Previous: fts.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct option and declares the variables
optarg, optind, opterr, optopt
and the functions getopt, getopt_long, getopt_long_only.
Documentation:
Gnulib module: getopt-gnu
Portability problems fixed by Gnulib:
getopt_long is missing on some platforms:
IRIX 6.5, OSF/1 5.1, Solaris 9.
getopt_long_only is missing on some platforms:
Mac OS X 10.3, FreeBSD 5.2.1, NetBSD 5.0, IRIX 6.5, OSF/1 5.1, Solaris 9, mingw.
getopt does not handle a leading ‘+’ character in
the options string on some platforms:
Solaris 11 2010-11.
Portability problems not fixed by Gnulib:
Next: ieee754.h, Previous: getopt.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct sgrp and declares the functions
setsgent, endsgent, getsgent, getsgnam,
sgetsgent, fgetsgent, putsgent,
getsgent_r, getsgnam_r, sgetsgent_r, fgetsgent_r.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ifaddrs.h, Previous: gshadow.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the types union ieee754_float, union ieee754_double,
union ieee854_long_double.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: libintl.h, Previous: ieee754.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct ifaddrs and declares the functions
getifaddrs, freeifaddrs.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mcheck.h, Previous: ifaddrs.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the macros __USE_GNU_GETTEXT,
__GNU_GETTEXT_SUPPORTED_REVISION, and declares the functions
gettext, dgettext, dcgettext,
ngettext, dngettext, dcngettext,
textdomain, bindtextdomain, bind_textdomain_codeset.
Documentation:
Gnulib module: gettext
Portability problems fixed by Gnulib, if GNU gettext is installed:
Portability problems not fixed by Gnulib:
Next: mntent.h, Previous: libintl.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type enum mcheck_status and declares the functions
mcheck, mcheck_pedantic, mcheck_check_all, mprobe,
mtrace, muntrace.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: obstack.h, Previous: mcheck.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct mntent and the macros MNTTAB,
MOUNTED, MNTTYPE_*, MNTOPT_*, and declares the functions
setmntent, getmntent, getmntent_r, addmntent,
endmntent, hasmntopt.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
getmntent_r is missing on all non-glibc platforms:
AIX 5.1, HP-UX 11, IRIX 6.5, Cygwin, Android 9.0.
Gnulib module mountlist provides a higher-level abstraction.
Next: paths.h, Previous: mntent.h, Up: Glibc Header File Substitutes [Contents][Index]
Documentation:
Gnulib module: obstack
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: printf.h, Previous: obstack.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the macros _PATH_*.
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
_PATH_* macros is platform dependent.
Next: pty.h, Previous: paths.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct printf_info and the macros and enum values
PA_*, and declares the functions
printf_function, printf_arginfo_function,
register_printf_function, parse_printf_format,
printf_size, printf_size_info.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: resolv.h, Previous: printf.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the functions openpty and forkpty.
Documentation:
Gnulib module: pty
Portability problems fixed by Gnulib:
forkpty and openpty functions in util.h or
libutil.h instead: Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0,
OpenBSD 3.8.
Portability problems not fixed by Gnulib:
Next: shadow.h, Previous: pty.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the types res_sendhookact, res_send_qhook,
res_send_rhook, res_state, struct res_sym and the
macros _PATH_RESCONF, RES_*, and declares the functions
fp_nquery, fp_query,
hostalias,
p_query,
res_close, res_init, res_isourserver,
res_mkquery, res_query, res_querydomain,
res_search, res_send.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys/ioctl.h, Previous: resolv.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct spwd and declares the functions
setspent, endspent,
getspent, getspent_r,
getspnam, getspnam_r,
sgetspent, sgetspent_r,
fgetspent, fgetspent_r,
putspent,
lckpwdf, ulckpwdf.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
getspent_r, getspnam_r, sgetspent_r,
fgetspent, fgetspent_r, putspent are missing on some
platforms:
HP-UX 11.
sgetspent, sgetspent_r are missing on some
platforms:
HP-UX 11, IRIX 6.5, Solaris 11.3.
Next: sysexits.h, Previous: shadow.h, Up: Glibc Header File Substitutes [Contents][Index]
Declares the function ioctl.
Documentation:
Gnulib module: sys_ioctl
Portability problems fixed by Gnulib:
ioctl function on some platforms:
AIX 5.1, Solaris 11.3, Haiku 2017.
Portability problems not fixed by Gnulib:
Next: ttyent.h, Previous: sys/ioctl.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the EX_* macros, including EX_OK.
Gnulib module: sysexits
Portability problems fixed by Gnulib:
EX_CONFIG is missing on some platforms:
HP-UX 11.
Portability problems not fixed by Gnulib:
Previous: sysexits.h, Up: Glibc Header File Substitutes [Contents][Index]
Defines the type struct ttyent and declares the functions
setttyent, endttyent, getttyent, getttynam.
Documentation:
Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Native Windows Support, Previous: Glibc Header File Substitutes, Up: GNU Gnulib [Contents][Index]
This chapter describes which functions and function-like macros provided as extensions by at least GNU libc are also supported by Gnulib, which portability pitfalls are fixed by Gnulib, and which (known) portability problems are not worked around by Gnulib.
The notation “Gnulib module: —” means that Gnulib does not provide a
module providing a substitute for the function. When the list
“Portability problems not fixed by Gnulib” is empty, such a module is
not needed: No portability problems are known. Otherwise, it indicates
that such a module would be useful but is not available: No one so far
found this function important enough to contribute a substitute for it.
If you need this particular function, you may write to
<bug-gnulib at gnu dot org>.
This list of functions is sorted according to the header that declares them.
<aio.h><aliases.h><argp.h><argz.h><arpa/inet.h><byteswap.h><complex.h><crypt.h><ctype.h><dirent.h><dlfcn.h><envz.h><err.h><errno.h><error.h><execinfo.h><fcntl.h><fenv.h><fmtmsg.h><fstab.h><fts.h><getopt.h><glob.h><gnu/libc-version.h><grp.h><gshadow.h><ifaddrs.h><libintl.h><link.h><malloc.h><math.h><mcheck.h><mntent.h><netdb.h><netinet/ether.h><netinet/in.h><obstack.h><printf.h><pthread.h><pty.h><pwd.h><regex.h><regexp.h><resolv.h><rpc/auth.h><rpc/auth_des.h><rpc/auth_unix.h><rpc/clnt.h><rpc/des_crypt.h><rpc/key_prot.h><rpc/netdb.h><rpc/pmap_clnt.h><rpc/pmap_prot.h><rpc/pmap_rmt.h><rpc/rpc_msg.h><rpc/svc.h><rpc/xdr.h><rpcsvc/nislib.h><rpcsvc/nis_callback.h><rpcsvc/yp.h><rpcsvc/yp_prot.h><rpcsvc/ypclnt.h><rpcsvc/ypupd.h><sched.h><search.h><selinux/selinux.h><shadow.h><signal.h><stdio.h><stdlib.h><string.h><sys/capability.h><sys/epoll.h><sys/fanotify.h><sys/file.h><sys/fsuid.h><sys/gmon.h><sys/io.h>, <sys/perm.h><sys/kdaemon.h><sys/klog.h><sys/mman.h><sys/mount.h><sys/personality.h><sys/prctl.h><sys/profil.h><sys/ptrace.h><sys/quota.h><sys/reboot.h><sys/resource.h><sys/sem.h><sys/sendfile.h><sys/socket.h><sys/stat.h><sys/statfs.h><sys/swap.h><sys/sysctl.h><sys/sysinfo.h><sys/syslog.h><sys/sysmacros.h><sys/time.h><sys/timex.h><sys/uio.h><sys/ustat.h><sys/vlimit.h><sys/vm86.h><sys/vtimes.h><sys/wait.h><sys/xattr.h><termios.h><time.h><ttyent.h><unistd.h><utmp.h><utmpx.h><wchar.h>
Next: Glibc <aliases.h>, Up: Glibc Function Substitutes [Contents][Index]
<aio.h>aio_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <argp.h>, Previous: Glibc Extensions to <aio.h>, Up: Glibc Function Substitutes [Contents][Index]
<aliases.h>
Next: getaliasbyname, Up: Glibc <aliases.h> [Contents][Index]
endaliasentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getaliasbyname_r, Previous: endaliasent, Up: Glibc <aliases.h> [Contents][Index]
getaliasbynameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getaliasent, Previous: getaliasbyname, Up: Glibc <aliases.h> [Contents][Index]
getaliasbyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getaliasent_r, Previous: getaliasbyname_r, Up: Glibc <aliases.h> [Contents][Index]
getaliasentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setaliasent, Previous: getaliasent, Up: Glibc <aliases.h> [Contents][Index]
getaliasent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getaliasent_r, Up: Glibc <aliases.h> [Contents][Index]
setaliasentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <argz.h>, Previous: Glibc <aliases.h>, Up: Glibc Function Substitutes [Contents][Index]
<argp.h>argp_err_exit_statusargp_errorargp_failureargp_helpargp_parseargp_program_bug_addressargp_program_versionargp_program_version_hookargp_state_helpargp_usage
Next: argp_error, Up: Glibc <argp.h> [Contents][Index]
argp_err_exit_statusGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_failure, Previous: argp_err_exit_status, Up: Glibc <argp.h> [Contents][Index]
argp_errorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_help, Previous: argp_error, Up: Glibc <argp.h> [Contents][Index]
argp_failureGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_parse, Previous: argp_failure, Up: Glibc <argp.h> [Contents][Index]
argp_helpGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_program_bug_address, Previous: argp_help, Up: Glibc <argp.h> [Contents][Index]
argp_parseGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_program_version, Previous: argp_parse, Up: Glibc <argp.h> [Contents][Index]
argp_program_bug_addressGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_program_version_hook, Previous: argp_program_bug_address, Up: Glibc <argp.h> [Contents][Index]
argp_program_versionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_state_help, Previous: argp_program_version, Up: Glibc <argp.h> [Contents][Index]
argp_program_version_hookGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argp_usage, Previous: argp_program_version_hook, Up: Glibc <argp.h> [Contents][Index]
argp_state_helpGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: argp_state_help, Up: Glibc <argp.h> [Contents][Index]
argp_usageGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <arpa/inet.h>, Previous: Glibc <argp.h>, Up: Glibc Function Substitutes [Contents][Index]
<argz.h>argz_addargz_add_separgz_appendargz_countargz_createargz_create_separgz_deleteargz_extractargz_insertargz_nextargz_replaceargz_stringify
Next: argz_add_sep, Up: Glibc <argz.h> [Contents][Index]
argz_addGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_append, Previous: argz_add, Up: Glibc <argz.h> [Contents][Index]
argz_add_sepGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_count, Previous: argz_add_sep, Up: Glibc <argz.h> [Contents][Index]
argz_appendGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_create, Previous: argz_append, Up: Glibc <argz.h> [Contents][Index]
argz_countGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_create_sep, Previous: argz_count, Up: Glibc <argz.h> [Contents][Index]
argz_createGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_delete, Previous: argz_create, Up: Glibc <argz.h> [Contents][Index]
argz_create_sepGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_extract, Previous: argz_create_sep, Up: Glibc <argz.h> [Contents][Index]
argz_deleteGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_insert, Previous: argz_delete, Up: Glibc <argz.h> [Contents][Index]
argz_extractGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_next, Previous: argz_extract, Up: Glibc <argz.h> [Contents][Index]
argz_insertGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_replace, Previous: argz_insert, Up: Glibc <argz.h> [Contents][Index]
argz_nextGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: argz_stringify, Previous: argz_next, Up: Glibc <argz.h> [Contents][Index]
argz_replaceGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: argz_replace, Up: Glibc <argz.h> [Contents][Index]
argz_stringifyGnulib module: argz
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <byteswap.h>, Previous: Glibc <argz.h>, Up: Glibc Function Substitutes [Contents][Index]
<arpa/inet.h>inet_atoninet_lnaofinet_makeaddrinet_net_ntopinet_net_ptoninet_netainet_netofinet_networkinet_nsap_addrinet_nsap_ntoa
Next: inet_lnaof, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_atonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_makeaddr, Previous: inet_aton, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_lnaofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_net_ntop, Previous: inet_lnaof, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_makeaddrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_net_pton, Previous: inet_makeaddr, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_net_ntopGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_neta, Previous: inet_net_ntop, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_net_ptonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_netof, Previous: inet_net_pton, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_netaGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_network, Previous: inet_neta, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_netofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_nsap_addr, Previous: inet_netof, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_networkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet_nsap_ntoa, Previous: inet_network, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_nsap_addrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: inet_nsap_addr, Up: Glibc Extensions to <arpa/inet.h> [Contents][Index]
inet_nsap_ntoaGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <complex.h>, Previous: Glibc Extensions to <arpa/inet.h>, Up: Glibc Function Substitutes [Contents][Index]
<byteswap.h>
Next: bswap_32, Up: Glibc <byteswap.h> [Contents][Index]
bswap_16Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: bswap_64, Previous: bswap_16, Up: Glibc <byteswap.h> [Contents][Index]
bswap_32Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: bswap_32, Up: Glibc <byteswap.h> [Contents][Index]
bswap_64Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <crypt.h>, Previous: Glibc <byteswap.h>, Up: Glibc Function Substitutes [Contents][Index]
<complex.h>
Next: clog10f, Up: Glibc Extensions to <complex.h> [Contents][Index]
clog10Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clog10l, Previous: clog10, Up: Glibc Extensions to <complex.h> [Contents][Index]
clog10fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: clog10f, Up: Glibc Extensions to <complex.h> [Contents][Index]
clog10lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <ctype.h>, Previous: Glibc Extensions to <complex.h>, Up: Glibc Function Substitutes [Contents][Index]
<crypt.h>
Next: encrypt_r, Up: Glibc <crypt.h> [Contents][Index]
crypt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setkey_r, Previous: crypt_r, Up: Glibc <crypt.h> [Contents][Index]
encrypt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: encrypt_r, Up: Glibc <crypt.h> [Contents][Index]
setkey_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <dirent.h>, Previous: Glibc <crypt.h>, Up: Glibc Function Substitutes [Contents][Index]
<ctype.h>isctypeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <dlfcn.h>, Previous: Glibc Extensions to <ctype.h>, Up: Glibc Function Substitutes [Contents][Index]
<dirent.h>
Next: scandirat, Up: Glibc Extensions to <dirent.h> [Contents][Index]
getdirentriesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on huge directories larger than 2 GB. The fix is to use
the AC_SYS_LARGEFILE macro.
Next: versionsort, Previous: getdirentries, Up: Glibc Extensions to <dirent.h> [Contents][Index]
scandiratGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: scandirat, Up: Glibc Extensions to <dirent.h> [Contents][Index]
versionsortGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <envz.h>, Previous: Glibc Extensions to <dirent.h>, Up: Glibc Function Substitutes [Contents][Index]
<dlfcn.h>
Next: dladdr1, Up: Glibc Extensions to <dlfcn.h> [Contents][Index]
dladdrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlinfo, Previous: dladdr, Up: Glibc Extensions to <dlfcn.h> [Contents][Index]
dladdr1Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlmopen, Previous: dladdr1, Up: Glibc Extensions to <dlfcn.h> [Contents][Index]
dlinfoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dlvsym, Previous: dlinfo, Up: Glibc Extensions to <dlfcn.h> [Contents][Index]
dlmopenGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: dlmopen, Up: Glibc Extensions to <dlfcn.h> [Contents][Index]
dlvsymGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <err.h>, Previous: Glibc Extensions to <dlfcn.h>, Up: Glibc Function Substitutes [Contents][Index]
<envz.h>
Next: envz_entry, Up: Glibc <envz.h> [Contents][Index]
envz_addGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: envz_get, Previous: envz_add, Up: Glibc <envz.h> [Contents][Index]
envz_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: envz_merge, Previous: envz_entry, Up: Glibc <envz.h> [Contents][Index]
envz_getGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: envz_remove, Previous: envz_get, Up: Glibc <envz.h> [Contents][Index]
envz_mergeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: envz_strip, Previous: envz_merge, Up: Glibc <envz.h> [Contents][Index]
envz_removeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: envz_remove, Up: Glibc <envz.h> [Contents][Index]
envz_stripGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <errno.h>, Previous: Glibc <envz.h>, Up: Glibc Function Substitutes [Contents][Index]
<err.h>
Next: errx, Up: Glibc <err.h> [Contents][Index]
errGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: verr, Previous: err, Up: Glibc <err.h> [Contents][Index]
errxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: verrx, Previous: errx, Up: Glibc <err.h> [Contents][Index]
verrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vwarn, Previous: verr, Up: Glibc <err.h> [Contents][Index]
verrxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vwarnx, Previous: verrx, Up: Glibc <err.h> [Contents][Index]
vwarnGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: warn, Previous: vwarn, Up: Glibc <err.h> [Contents][Index]
vwarnxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: warnx, Previous: vwarnx, Up: Glibc <err.h> [Contents][Index]
warnGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: warn, Up: Glibc <err.h> [Contents][Index]
warnxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <error.h>, Previous: Glibc <err.h>, Up: Glibc Function Substitutes [Contents][Index]
<errno.h>program_invocation_nameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: program_invocation_name, Up: Glibc Extensions to <errno.h> [Contents][Index]
program_invocation_short_nameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <execinfo.h>, Previous: Glibc Extensions to <errno.h>, Up: Glibc Function Substitutes [Contents][Index]
<error.h>
Next: error_at_line, Up: Glibc <error.h> [Contents][Index]
errorGnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: error_message_count, Previous: error, Up: Glibc <error.h> [Contents][Index]
error_at_lineGnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: error_one_per_line, Previous: error_at_line, Up: Glibc <error.h> [Contents][Index]
error_message_countGnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: error_print_progname, Previous: error_message_count, Up: Glibc <error.h> [Contents][Index]
error_one_per_lineGnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: error_one_per_line, Up: Glibc <error.h> [Contents][Index]
error_print_prognameGnulib module: error
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <fcntl.h>, Previous: Glibc <error.h>, Up: Glibc Function Substitutes [Contents][Index]
<execinfo.h>
Next: backtrace_symbols, Up: Glibc <execinfo.h> [Contents][Index]
backtraceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: backtrace_symbols_fd, Previous: backtrace, Up: Glibc <execinfo.h> [Contents][Index]
backtrace_symbolsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: backtrace_symbols, Up: Glibc <execinfo.h> [Contents][Index]
backtrace_symbols_fdGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <fenv.h>, Previous: Glibc <execinfo.h>, Up: Glibc Function Substitutes [Contents][Index]
<fcntl.h>
Next: name_to_handle_at, Up: Glibc Extensions to <fcntl.h> [Contents][Index]
fallocateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly across the entire data range of files larger than 2 GB.
The fix is to use the AC_SYS_LARGEFILE macro.
Next: readahead, Previous: fallocate, Up: Glibc Extensions to <fcntl.h> [Contents][Index]
name_to_handle_atGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: open_by_handle_at, Previous: name_to_handle_at, Up: Glibc Extensions to <fcntl.h> [Contents][Index]
readaheadGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: readahead, Up: Glibc Extensions to <fcntl.h> [Contents][Index]
open_by_handle_atGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <fmtmsg.h>, Previous: Glibc Extensions to <fcntl.h>, Up: Glibc Function Substitutes [Contents][Index]
<fenv.h>
Next: feenableexcept, Up: Glibc Extensions to <fenv.h> [Contents][Index]
fedisableexceptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fegetexcept, Previous: fedisableexcept, Up: Glibc Extensions to <fenv.h> [Contents][Index]
feenableexceptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: feenableexcept, Up: Glibc Extensions to <fenv.h> [Contents][Index]
fegetexceptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <fstab.h>, Previous: Glibc Extensions to <fenv.h>, Up: Glibc Function Substitutes [Contents][Index]
<fmtmsg.h>addseverityGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <fts.h>, Previous: Glibc Extensions to <fmtmsg.h>, Up: Glibc Function Substitutes [Contents][Index]
<fstab.h>
Next: getfsent, Up: Glibc <fstab.h> [Contents][Index]
endfsentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getfsfile, Previous: endfsent, Up: Glibc <fstab.h> [Contents][Index]
getfsentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getfsspec, Previous: getfsent, Up: Glibc <fstab.h> [Contents][Index]
getfsfileGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setfsent, Previous: getfsfile, Up: Glibc <fstab.h> [Contents][Index]
getfsspecGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getfsspec, Up: Glibc <fstab.h> [Contents][Index]
setfsentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <getopt.h>, Previous: Glibc <fstab.h>, Up: Glibc Function Substitutes [Contents][Index]
<fts.h>
Next: fts_close, Up: Glibc <fts.h> [Contents][Index]
fts_childrenGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
correctly report the size of files or block devices larger than 2 GB and
may not work correctly on huge directories larger than 2 GB. Also, on
platforms where ino_t is a 32-bit type, this function may report
inode numbers incorrectly. The fix is to use the AC_SYS_LARGEFILE
macro (only on Mac OS X systems).
Next: fts_open, Previous: fts_children, Up: Glibc <fts.h> [Contents][Index]
fts_closeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fts_read, Previous: fts_close, Up: Glibc <fts.h> [Contents][Index]
fts_openGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fts_set, Previous: fts_open, Up: Glibc <fts.h> [Contents][Index]
fts_readGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
correctly report the size of files or block devices larger than 2 GB and
may not work correctly on huge directories larger than 2 GB. Also, on
platforms where ino_t is a 32-bit type, this function may report
inode numbers incorrectly. The fix is to use the AC_SYS_LARGEFILE
macro (only on Mac OS X systems).
Previous: fts_read, Up: Glibc <fts.h> [Contents][Index]
fts_setGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <glob.h>, Previous: Glibc <fts.h>, Up: Glibc Function Substitutes [Contents][Index]
<getopt.h>
Next: getopt_long_only, Up: Glibc <getopt.h> [Contents][Index]
getopt_longGnulib module: getopt-gnu
Portability problems fixed by Gnulib:
getopt_long does not obey the combination of
‘+’ and ‘:’ flags in the options string on some platforms:
glibc 2.11.
-W foo to behave synonymously with --foo:
glibc 2.11.
getopt_long does not support the ‘+’ flag in
the options string on some platforms:
Mac OS X 10.5, AIX 5.2, OSF/1 5.1, Solaris 10.
optind after a missing required argument is wrong
on some platforms:
Mac OS X 10.5.
getopt_long does not obey the ‘-’ flag in the
options string when POSIXLY_CORRECT is set on some platforms:
Cygwin 1.7.0.
POSIXLY_CORRECT, when optind is set to ‘0’:
NetBSD, Cygwin 1.7.0.
getopt_long does not support options with optional
arguments on some platforms:
Mac OS X 10.5, OpenBSD 4.0, AIX 5.2, IRIX 6.5, Solaris 11 2010-11, Cygwin 1.5.x.
W; but
there are no long options, on some platforms:
glibc 2.14.
Portability problems not fixed by Gnulib:
Previous: getopt_long, Up: Glibc <getopt.h> [Contents][Index]
getopt_long_onlyGnulib module: getopt-gnu
Portability problems fixed by Gnulib:
getopt_long_only does not obey the combination of
‘+’ and ‘:’ flags in the options string on some platforms:
glibc 2.11.
-W foo to behave synonymously with --foo:
glibc 2.11.
getopt_long_only does not support the ‘+’
flag in the options string on some platforms:
Mac OS X 10.5, AIX 5.2, OSF/1 5.1, Solaris 10.
optind after a missing required argument is wrong
on some platforms:
Mac OS X 10.5.
getopt_long_only does not obey the ‘-’ flag
in the options string when POSIXLY_CORRECT is set on some platforms:
Cygwin 1.7.0.
POSIXLY_CORRECT, when optind is set to ‘0’:
NetBSD, Cygwin 1.7.0.
getopt_long_only does not support options with
optional arguments on some platforms:
Mac OS X 10.5, OpenBSD 4.0, AIX 5.2, Solaris 11 2010-11, Cygwin 1.5.x.
W; but
there are no long options, on some platforms:
glibc 2.14.
Portability problems not fixed by Gnulib:
getopt_long_only
in new programs.
Next: Glibc Extensions to <gnu/libc-version.h>, Previous: Glibc <getopt.h>, Up: Glibc Function Substitutes [Contents][Index]
<glob.h>glob_pattern_pGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <grp.h>, Previous: Glibc Extensions to <glob.h>, Up: Glibc Function Substitutes [Contents][Index]
<gnu/libc-version.h>gnu_get_libc_releaseGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: gnu_get_libc_release, Up: Glibc Extensions to <gnu/libc-version.h> [Contents][Index]
gnu_get_libc_versionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <gshadow.h>, Previous: Glibc Extensions to <gnu/libc-version.h>, Up: Glibc Function Substitutes [Contents][Index]
<grp.h>
Next: fgetgrent_r, Up: Glibc Extensions to <grp.h> [Contents][Index]
fgetgrentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrent_r, Previous: fgetgrent, Up: Glibc Extensions to <grp.h> [Contents][Index]
fgetgrent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getgrouplist, Previous: fgetgrent_r, Up: Glibc Extensions to <grp.h> [Contents][Index]
getgrent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: initgroups, Previous: getgrent_r, Up: Glibc Extensions to <grp.h> [Contents][Index]
getgrouplistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
int instead of gid_t parameters
on some platforms: OS X 10.11.
The Gnulib module getugroups provides a similar API.
Next: putgrent, Previous: getgrouplist, Up: Glibc Extensions to <grp.h> [Contents][Index]
initgroupsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
fork and exec if
the parent process is multi-threaded. Instead, use getgroups or
getgrouplist (or use the gnulib module mgetgroups)
before forking, and setgroups in the child.
Next: setgroups, Previous: initgroups, Up: Glibc Extensions to <grp.h> [Contents][Index]
putgrentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: putgrent, Up: Glibc Extensions to <grp.h> [Contents][Index]
setgroupsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
GETGROUPS_T to
the appropriate size (since getgroups and setgroups
share the same bug).
Next: Glibc <ifaddrs.h>, Previous: Glibc Extensions to <grp.h>, Up: Glibc Function Substitutes [Contents][Index]
<gshadow.h>endsgentfgetsgentfgetsgent_rgetsgentgetsgent_rgetsgnamgetsgnam_rputsgentsetsgentsgetsgentsgetsgent_r
Next: fgetsgent, Up: Glibc <gshadow.h> [Contents][Index]
endsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fgetsgent_r, Previous: endsgent, Up: Glibc <gshadow.h> [Contents][Index]
fgetsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsgent, Previous: fgetsgent, Up: Glibc <gshadow.h> [Contents][Index]
fgetsgent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsgent_r, Previous: fgetsgent_r, Up: Glibc <gshadow.h> [Contents][Index]
getsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsgnam, Previous: getsgent, Up: Glibc <gshadow.h> [Contents][Index]
getsgent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsgnam_r, Previous: getsgent_r, Up: Glibc <gshadow.h> [Contents][Index]
getsgnamGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putsgent, Previous: getsgnam, Up: Glibc <gshadow.h> [Contents][Index]
getsgnam_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setsgent, Previous: getsgnam_r, Up: Glibc <gshadow.h> [Contents][Index]
putsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sgetsgent, Previous: putsgent, Up: Glibc <gshadow.h> [Contents][Index]
setsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sgetsgent_r, Previous: setsgent, Up: Glibc <gshadow.h> [Contents][Index]
sgetsgentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: sgetsgent, Up: Glibc <gshadow.h> [Contents][Index]
sgetsgent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <libintl.h>, Previous: Glibc <gshadow.h>, Up: Glibc Function Substitutes [Contents][Index]
<ifaddrs.h>
Next: freeifaddrs, Up: Glibc <ifaddrs.h> [Contents][Index]
getifaddrsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getifaddrs, Up: Glibc <ifaddrs.h> [Contents][Index]
freeifaddrsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <link.h>, Previous: Glibc <ifaddrs.h>, Up: Glibc Function Substitutes [Contents][Index]
<libintl.h>bind_textdomain_codesetbindtextdomaindcgettextdcngettextdgettextdngettextgettextngettexttextdomain
Next: bindtextdomain, Up: Glibc <libintl.h> [Contents][Index]
bind_textdomain_codesetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dcgettext, Previous: bind_textdomain_codeset, Up: Glibc <libintl.h> [Contents][Index]
bindtextdomainGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dcngettext, Previous: bindtextdomain, Up: Glibc <libintl.h> [Contents][Index]
dcgettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dgettext, Previous: dcgettext, Up: Glibc <libintl.h> [Contents][Index]
dcngettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dngettext, Previous: dcngettext, Up: Glibc <libintl.h> [Contents][Index]
dgettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gettext, Previous: dgettext, Up: Glibc <libintl.h> [Contents][Index]
dngettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ngettext, Previous: dngettext, Up: Glibc <libintl.h> [Contents][Index]
gettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: textdomain, Previous: gettext, Up: Glibc <libintl.h> [Contents][Index]
ngettextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ngettext, Up: Glibc <libintl.h> [Contents][Index]
textdomainGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <malloc.h>, Previous: Glibc <libintl.h>, Up: Glibc Function Substitutes [Contents][Index]
<link.h>
Up: Glibc <link.h> [Contents][Index]
dl_iterate_phdrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <math.h>, Previous: Glibc <link.h>, Up: Glibc Function Substitutes [Contents][Index]
<malloc.h>mallinfomalloc_get_statemalloc_set_statemalloc_infomalloc_statsmalloc_trimmalloc_usable_sizemalloptmemalignpvalloc
Next: malloc_get_state, Up: Glibc <malloc.h> [Contents][Index]
mallinfoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: malloc_set_state, Previous: mallinfo, Up: Glibc <malloc.h> [Contents][Index]
malloc_get_stateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: malloc_info, Previous: malloc_get_state, Up: Glibc <malloc.h> [Contents][Index]
malloc_set_stateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: malloc_stats, Previous: malloc_set_state, Up: Glibc <malloc.h> [Contents][Index]
malloc_infoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: malloc_trim, Previous: malloc_info, Up: Glibc <malloc.h> [Contents][Index]
malloc_statsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: malloc_usable_size, Previous: malloc_stats, Up: Glibc <malloc.h> [Contents][Index]
malloc_trimGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mallopt, Previous: malloc_trim, Up: Glibc <malloc.h> [Contents][Index]
malloc_usable_sizeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memalign, Previous: malloc_usable_size, Up: Glibc <malloc.h> [Contents][Index]
malloptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pvalloc, Previous: mallopt, Up: Glibc <malloc.h> [Contents][Index]
memalignGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: memalign, Up: Glibc <malloc.h> [Contents][Index]
pvallocGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <mcheck.h>, Previous: Glibc <malloc.h>, Up: Glibc Function Substitutes [Contents][Index]
<math.h>dremdremfdremlexp10exp10fexp10lfinitefiniteffinitelgammagammafgammalisinffisinflisnanfisnanlj0fj0lj1fj1ljnfjnllgamma_rlgammaf_rlgammal_rmatherrpow10pow10fpow10lscalbfscalblsignificandsignificandfsignificandlsincossincosfsincosly0fy0ly1fy1lynfynl
Next: dremf, Up: Glibc Extensions to <math.h> [Contents][Index]
dremGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dreml, Previous: drem, Up: Glibc Extensions to <math.h> [Contents][Index]
dremfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp10, Previous: dremf, Up: Glibc Extensions to <math.h> [Contents][Index]
dremlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp10f, Previous: dreml, Up: Glibc Extensions to <math.h> [Contents][Index]
exp10Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: exp10l, Previous: exp10, Up: Glibc Extensions to <math.h> [Contents][Index]
exp10fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: finite, Previous: exp10f, Up: Glibc Extensions to <math.h> [Contents][Index]
exp10lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: finitef, Previous: exp10l, Up: Glibc Extensions to <math.h> [Contents][Index]
finiteGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: finitel, Previous: finite, Up: Glibc Extensions to <math.h> [Contents][Index]
finitefGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gamma, Previous: finitef, Up: Glibc Extensions to <math.h> [Contents][Index]
finitelGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gammaf, Previous: finitel, Up: Glibc Extensions to <math.h> [Contents][Index]
gammaGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gammal, Previous: gamma, Up: Glibc Extensions to <math.h> [Contents][Index]
gammafGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isinff, Previous: gammaf, Up: Glibc Extensions to <math.h> [Contents][Index]
gammalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isinfl, Previous: gammal, Up: Glibc Extensions to <math.h> [Contents][Index]
isinffGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isnanf, Previous: isinff, Up: Glibc Extensions to <math.h> [Contents][Index]
isinflGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: isnanl, Previous: isinfl, Up: Glibc Extensions to <math.h> [Contents][Index]
isnanfGnulib module: isnanf
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: j0f, Previous: isnanf, Up: Glibc Extensions to <math.h> [Contents][Index]
isnanlGnulib module: isnanl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: j0l, Previous: isnanl, Up: Glibc Extensions to <math.h> [Contents][Index]
j0fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: j1f, Previous: j0f, Up: Glibc Extensions to <math.h> [Contents][Index]
j0lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: j1l, Previous: j0l, Up: Glibc Extensions to <math.h> [Contents][Index]
j1fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: jnf, Previous: j1f, Up: Glibc Extensions to <math.h> [Contents][Index]
j1lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: jnl, Previous: j1l, Up: Glibc Extensions to <math.h> [Contents][Index]
jnfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgamma_r, Previous: jnf, Up: Glibc Extensions to <math.h> [Contents][Index]
jnlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgammaf_r, Previous: jnl, Up: Glibc Extensions to <math.h> [Contents][Index]
lgamma_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgammal_r, Previous: lgamma_r, Up: Glibc Extensions to <math.h> [Contents][Index]
lgammaf_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: matherr, Previous: lgammaf_r, Up: Glibc Extensions to <math.h> [Contents][Index]
lgammal_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pow10, Previous: lgammal_r, Up: Glibc Extensions to <math.h> [Contents][Index]
matherrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pow10f, Previous: matherr, Up: Glibc Extensions to <math.h> [Contents][Index]
pow10Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pow10l, Previous: pow10, Up: Glibc Extensions to <math.h> [Contents][Index]
pow10fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalbf, Previous: pow10f, Up: Glibc Extensions to <math.h> [Contents][Index]
pow10lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: scalbl, Previous: pow10l, Up: Glibc Extensions to <math.h> [Contents][Index]
scalbfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: significand, Previous: scalbf, Up: Glibc Extensions to <math.h> [Contents][Index]
scalblGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: significandf, Previous: scalbl, Up: Glibc Extensions to <math.h> [Contents][Index]
significandGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: significandl, Previous: significand, Up: Glibc Extensions to <math.h> [Contents][Index]
significandfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sincos, Previous: significandf, Up: Glibc Extensions to <math.h> [Contents][Index]
significandlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sincosf, Previous: significandl, Up: Glibc Extensions to <math.h> [Contents][Index]
sincosGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sincosl, Previous: sincos, Up: Glibc Extensions to <math.h> [Contents][Index]
sincosfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: y0f, Previous: sincosf, Up: Glibc Extensions to <math.h> [Contents][Index]
sincoslGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: y0l, Previous: sincosl, Up: Glibc Extensions to <math.h> [Contents][Index]
y0fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: y1f, Previous: y0f, Up: Glibc Extensions to <math.h> [Contents][Index]
y0lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: y1l, Previous: y0l, Up: Glibc Extensions to <math.h> [Contents][Index]
y1fGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ynf, Previous: y1f, Up: Glibc Extensions to <math.h> [Contents][Index]
y1lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ynl, Previous: y1l, Up: Glibc Extensions to <math.h> [Contents][Index]
ynfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ynf, Up: Glibc Extensions to <math.h> [Contents][Index]
ynlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <mntent.h>, Previous: Glibc Extensions to <math.h>, Up: Glibc Function Substitutes [Contents][Index]
<mcheck.h>
Next: mcheck_check_all, Up: Glibc <mcheck.h> [Contents][Index]
mcheckGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mcheck_pedantic, Previous: mcheck, Up: Glibc <mcheck.h> [Contents][Index]
mcheck_check_allGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mprobe, Previous: mcheck_check_all, Up: Glibc <mcheck.h> [Contents][Index]
mcheck_pedanticGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mtrace, Previous: mcheck_pedantic, Up: Glibc <mcheck.h> [Contents][Index]
mprobeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: muntrace, Previous: mprobe, Up: Glibc <mcheck.h> [Contents][Index]
mtraceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: mtrace, Up: Glibc <mcheck.h> [Contents][Index]
muntraceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <netdb.h>, Previous: Glibc <mcheck.h>, Up: Glibc Function Substitutes [Contents][Index]
<mntent.h>
Next: endmntent, Up: Glibc <mntent.h> [Contents][Index]
addmntentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getmntent, Previous: addmntent, Up: Glibc <mntent.h> [Contents][Index]
endmntentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getmntent_r, Previous: endmntent, Up: Glibc <mntent.h> [Contents][Index]
getmntentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hasmntopt, Previous: getmntent, Up: Glibc <mntent.h> [Contents][Index]
getmntent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setmntent, Previous: getmntent_r, Up: Glibc <mntent.h> [Contents][Index]
hasmntoptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: hasmntopt, Up: Glibc <mntent.h> [Contents][Index]
setmntentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <netinet/ether.h>, Previous: Glibc <mntent.h>, Up: Glibc Function Substitutes [Contents][Index]
<netdb.h>endnetgrentgethostbyaddr_rgethostbyname2gethostbyname2_rgethostbyname_rgethostent_rgetnetbyaddr_rgetnetbyname_rgetnetent_rgetnetgrentgetnetgrent_rgetprotobyname_rgetprotobynumber_rgetprotoent_rgetservbyname_rgetservbyport_rgetservent_rherrorhstrerrorinnetgrrcmdrcmd_afrexecrexec_afrresvportrresvport_afruserokruserok_afsetnetgrent
Next: gethostbyaddr_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
endnetgrentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostbyname2, Previous: endnetgrent, Up: Glibc Extensions to <netdb.h> [Contents][Index]
gethostbyaddr_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostbyname2_r, Previous: gethostbyaddr_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
gethostbyname2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostbyname_r, Previous: gethostbyname2, Up: Glibc Extensions to <netdb.h> [Contents][Index]
gethostbyname2_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: gethostent_r, Previous: gethostbyname2_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
gethostbyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetbyaddr_r, Previous: gethostbyname_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
gethostent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetbyname_r, Previous: gethostent_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getnetbyaddr_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetent_r, Previous: getnetbyaddr_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getnetbyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetgrent, Previous: getnetbyname_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getnetent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetgrent_r, Previous: getnetent_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getnetgrentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotobyname_r, Previous: getnetgrent, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getnetgrent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotobynumber_r, Previous: getnetgrent_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getprotobyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getprotoent_r, Previous: getprotobyname_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getprotobynumber_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getservbyname_r, Previous: getprotobynumber_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getprotoent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getservbyport_r, Previous: getprotoent_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getservbyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getservent_r, Previous: getservbyname_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getservbyport_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: herror, Previous: getservbyport_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
getservent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hstrerror, Previous: getservent_r, Up: Glibc Extensions to <netdb.h> [Contents][Index]
herrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: innetgr, Previous: herror, Up: Glibc Extensions to <netdb.h> [Contents][Index]
hstrerrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rcmd, Previous: hstrerror, Up: Glibc Extensions to <netdb.h> [Contents][Index]
innetgrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rcmd_af, Previous: innetgr, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rcmdGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rexec, Previous: rcmd, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rcmd_afGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rexec_af, Previous: rcmd_af, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rexecGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rresvport, Previous: rexec, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rexec_afGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rresvport_af, Previous: rexec_af, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rresvportGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ruserok, Previous: rresvport, Up: Glibc Extensions to <netdb.h> [Contents][Index]
rresvport_afGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ruserok_af, Previous: rresvport_af, Up: Glibc Extensions to <netdb.h> [Contents][Index]
ruserokGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setnetgrent, Previous: ruserok, Up: Glibc Extensions to <netdb.h> [Contents][Index]
ruserok_afGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ruserok_af, Up: Glibc Extensions to <netdb.h> [Contents][Index]
setnetgrentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <netinet/in.h>, Previous: Glibc Extensions to <netdb.h>, Up: Glibc Function Substitutes [Contents][Index]
<netinet/ether.h>
Next: ether_aton_r, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_atonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ether_hostton, Previous: ether_aton, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_aton_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ether_line, Previous: ether_aton_r, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_hosttonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ether_ntoa, Previous: ether_hostton, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_lineGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ether_ntoa_r, Previous: ether_line, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_ntoaGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ether_ntohost, Previous: ether_ntoa, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_ntoa_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ether_ntoa_r, Up: Glibc <netinet/ether.h> [Contents][Index]
ether_ntohostGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <obstack.h>, Previous: Glibc <netinet/ether.h>, Up: Glibc Function Substitutes [Contents][Index]
<netinet/in.h>bindresvportgetipv4sourcefiltergetsourcefilterin6addr_anyin6addr_loopbackinet6_option_allocinet6_option_appendinet6_option_findinet6_option_initinet6_option_nextinet6_option_spaceinet6_opt_appendinet6_opt_findinet6_opt_finishinet6_opt_get_valinet6_opt_initinet6_opt_nextinet6_opt_set_valinet6_rth_addinet6_rth_getaddrinet6_rth_initinet6_rth_reverseinet6_rth_segmentsinet6_rth_spacesetipv4sourcefiltersetsourcefilter
Next: getipv4sourcefilter, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
bindresvportGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsourcefilter, Previous: bindresvport, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
getipv4sourcefilterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: in6addr_any, Previous: getipv4sourcefilter, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
getsourcefilterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: in6addr_loopback, Previous: getsourcefilter, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
in6addr_anyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_alloc, Previous: in6addr_any, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
in6addr_loopbackGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_append, Previous: in6addr_loopback, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_allocGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_find, Previous: inet6_option_alloc, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_appendGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_init, Previous: inet6_option_append, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_findGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_next, Previous: inet6_option_find, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_option_space, Previous: inet6_option_init, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_nextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_append, Previous: inet6_option_next, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_option_spaceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_find, Previous: inet6_option_space, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_appendGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_finish, Previous: inet6_opt_append, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_findGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_get_val, Previous: inet6_opt_find, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_finishGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_init, Previous: inet6_opt_finish, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_get_valGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_next, Previous: inet6_opt_get_val, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_opt_set_val, Previous: inet6_opt_init, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_nextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_add, Previous: inet6_opt_next, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_opt_set_valGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_getaddr, Previous: inet6_opt_set_val, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_addGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_init, Previous: inet6_rth_add, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_getaddrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_reverse, Previous: inet6_rth_getaddr, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_segments, Previous: inet6_rth_init, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_reverseGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: inet6_rth_space, Previous: inet6_rth_reverse, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_segmentsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setipv4sourcefilter, Previous: inet6_rth_segments, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
inet6_rth_spaceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setsourcefilter, Previous: inet6_rth_space, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
setipv4sourcefilterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: setipv4sourcefilter, Up: Glibc Extensions to <netinet/in.h> [Contents][Index]
setsourcefilterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <printf.h>, Previous: Glibc Extensions to <netinet/in.h>, Up: Glibc Function Substitutes [Contents][Index]
<obstack.h>
Next: obstack_exit_failure, Up: Glibc <obstack.h> [Contents][Index]
obstack_alloc_failed_handlerGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: obstack_free, Previous: obstack_alloc_failed_handler, Up: Glibc <obstack.h> [Contents][Index]
obstack_exit_failureGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: obstack_printf, Previous: obstack_exit_failure, Up: Glibc <obstack.h> [Contents][Index]
obstack_freeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: obstack_vprintf, Previous: obstack_free, Up: Glibc <obstack.h> [Contents][Index]
obstack_printfGnulib module: obstack-printf or obstack-printf-posix
Portability problems fixed by either Gnulib module
obstack-printf or obstack-printf-posix:
Portability problems fixed by Gnulib module ostack-printf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Previous: obstack_printf, Up: Glibc <obstack.h> [Contents][Index]
obstack_vprintfGnulib module: obstack-printf or obstack-printf-posix
Portability problems fixed by either Gnulib module
obstack-printf or obstack-printf-posix:
Portability problems fixed by Gnulib module ostack-printf-posix:
hh, ll,
j, t, z) on some platforms:
AIX 5.1, HP-UX 11.23, IRIX 6.5, OSF/1 5.1, Solaris 9, Cygwin 1.5.24, mingw, MSVC 14, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
AIX 5.2, OSF/1 5.1, Solaris 11.0, mingw, MSVC 14.
"%2$s", on some platforms:
NetBSD 3.0, mingw, MSVC 14, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24, mingw, MSVC 14.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, AIX 5.2, IRIX 6.5, OSF/1 5.1, Solaris 11.0, Cygwin 1.5.x, mingw, MSVC 14.
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <pthread.h>, Previous: Glibc <obstack.h>, Up: Glibc Function Substitutes [Contents][Index]
<printf.h>parse_printf_formatprintf_sizeprintf_size_inforegister_printf_functionregister_printf_modifierregister_printf_specifierregister_printf_type
Next: printf_size, Up: Glibc <printf.h> [Contents][Index]
parse_printf_formatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: printf_size_info, Previous: parse_printf_format, Up: Glibc <printf.h> [Contents][Index]
printf_sizeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: register_printf_function, Previous: printf_size, Up: Glibc <printf.h> [Contents][Index]
printf_size_infoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: register_printf_modifier, Previous: printf_size_info, Up: Glibc <printf.h> [Contents][Index]
register_printf_functionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: register_printf_specifier, Previous: register_printf_function, Up: Glibc <printf.h> [Contents][Index]
register_printf_modifierGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: register_printf_type, Previous: register_printf_modifier, Up: Glibc <printf.h> [Contents][Index]
register_printf_specifierGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: register_printf_specifier, Up: Glibc <printf.h> [Contents][Index]
register_printf_typeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <pty.h>, Previous: Glibc <printf.h>, Up: Glibc Function Substitutes [Contents][Index]
<pthread.h>pthread_attr_getaffinity_nppthread_attr_setaffinity_nppthread_getaffinity_nppthread_getattr_nppthread_getname_nppthread_kill_other_threads_nppthread_mutex_consistent_nppthread_mutexattr_getrobust_nppthread_mutexattr_setrobust_nppthread_rwlockattr_getkind_nppthread_rwlockattr_setkind_nppthread_setaffinity_nppthread_setname_nppthread_sigqueuepthread_timedjoin_nppthread_tryjoin_nppthread_yieldpthread_attr_getaffinity_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getaffinity_np, Previous: pthread_attr_getaffinity_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_attr_setaffinity_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getattr_np, Previous: pthread_attr_setaffinity_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_getaffinity_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_getname_np, Previous: pthread_getaffinity_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_getattr_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_kill_other_threads_np, Previous: pthread_getattr_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_getname_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutex_consistent_np, Previous: pthread_getname_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_kill_other_threads_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_getrobust_np, Previous: pthread_kill_other_threads_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_mutex_consistent_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_mutexattr_setrobust_np, Previous: pthread_mutex_consistent_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_mutexattr_getrobust_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
This function has now been standardized by POSIX under the name
pthread_mutexattr_getrobust.
Next: pthread_rwlockattr_getkind_np, Previous: pthread_mutexattr_getrobust_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_mutexattr_setrobust_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
This function has now been standardized by POSIX under the name
pthread_mutexattr_setrobust.
Next: pthread_rwlockattr_setkind_np, Previous: pthread_mutexattr_setrobust_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_rwlockattr_getkind_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setaffinity_np, Previous: pthread_rwlockattr_getkind_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_rwlockattr_setkind_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_setname_np, Previous: pthread_rwlockattr_setkind_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_setaffinity_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_sigqueue, Previous: pthread_setaffinity_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_setname_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
NULL.
On NetBSD the second argument is interpreted as a printf format string,
with the third argument as parameter.
Next: pthread_timedjoin_np, Previous: pthread_setname_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_sigqueueGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pthread_tryjoin_np, Previous: pthread_sigqueue, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_timedjoin_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
libthr but not in
libpthread, and it also is missing a declaration.
Next: pthread_yield, Previous: pthread_timedjoin_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_tryjoin_npGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: pthread_tryjoin_np, Up: Glibc Extensions to <pthread.h> [Contents][Index]
pthread_yieldGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <pwd.h>, Previous: Glibc Extensions to <pthread.h>, Up: Glibc Function Substitutes [Contents][Index]
<pty.h>
Next: openpty, Up: Glibc <pty.h> [Contents][Index]
forkptyGnulib module: forkpty
Portability problems fixed by Gnulib:
-lutil is not required.
-lutil is
required.
const.
FreeBSD, Cygwin 1.7.1.
Portability problems not fixed by Gnulib:
Previous: forkpty, Up: Glibc <pty.h> [Contents][Index]
openptyGnulib module: openpty
Portability problems fixed by Gnulib:
-lutil is not required.
-lutil is
required.
const.
FreeBSD, Cygwin 1.7.1.
Portability problems not fixed by Gnulib:
openpty, the application needs to close
the master’s file descriptor before closing the slave’s file descriptor,
otherwise the process may hang in a state where it cannot be killed, on
some platforms: Mac OS X 10.4.11.
Next: Glibc Extensions to <regex.h>, Previous: Glibc <pty.h>, Up: Glibc Function Substitutes [Contents][Index]
<pwd.h>
Next: fgetpwent_r, Up: Glibc Extensions to <pwd.h> [Contents][Index]
fgetpwentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpw, Previous: fgetpwent, Up: Glibc Extensions to <pwd.h> [Contents][Index]
fgetpwent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpwent_r, Previous: fgetpwent_r, Up: Glibc Extensions to <pwd.h> [Contents][Index]
getpwGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putpwent, Previous: getpw, Up: Glibc Extensions to <pwd.h> [Contents][Index]
getpwent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getpwent_r, Up: Glibc Extensions to <pwd.h> [Contents][Index]
putpwentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <regexp.h>, Previous: Glibc Extensions to <pwd.h>, Up: Glibc Function Substitutes [Contents][Index]
<regex.h>re_compre_compile_fastmapre_compile_patternre_execre_matchre_match_2re_searchre_search_2re_set_registersre_set_syntaxre_syntax_options
Next: re_compile_fastmap, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_compGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_compile_pattern, Previous: re_comp, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_compile_fastmapGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_exec, Previous: re_compile_fastmap, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_compile_patternGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_match, Previous: re_compile_pattern, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_execGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_match_2, Previous: re_exec, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_matchGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_search, Previous: re_match, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_match_2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_search_2, Previous: re_match_2, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_searchGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_set_registers, Previous: re_search, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_search_2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_set_syntax, Previous: re_search_2, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_set_registersGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: re_syntax_options, Previous: re_set_registers, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_set_syntaxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: re_set_syntax, Up: Glibc Extensions to <regex.h> [Contents][Index]
re_syntax_optionsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <resolv.h>, Previous: Glibc Extensions to <regex.h>, Up: Glibc Function Substitutes [Contents][Index]
<regexp.h>
Next: loc1, Up: Glibc <regexp.h> [Contents][Index]
advanceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: loc2, Previous: advance, Up: Glibc <regexp.h> [Contents][Index]
loc1Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: locs, Previous: loc1, Up: Glibc <regexp.h> [Contents][Index]
loc2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: step, Previous: loc2, Up: Glibc <regexp.h> [Contents][Index]
locsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: locs, Up: Glibc <regexp.h> [Contents][Index]
stepGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/auth.h>, Previous: Glibc <regexp.h>, Up: Glibc Function Substitutes [Contents][Index]
<resolv.h>
Next: res_init, Up: Glibc <resolv.h> [Contents][Index]
dn_expandGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: res_mkquery, Previous: dn_expand, Up: Glibc <resolv.h> [Contents][Index]
res_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: res_query, Previous: res_init, Up: Glibc <resolv.h> [Contents][Index]
res_mkqueryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: res_querydomain, Previous: res_mkquery, Up: Glibc <resolv.h> [Contents][Index]
res_queryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: res_search, Previous: res_query, Up: Glibc <resolv.h> [Contents][Index]
res_querydomainGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: res_querydomain, Up: Glibc <resolv.h> [Contents][Index]
res_searchGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/auth_des.h>, Previous: Glibc <resolv.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/auth.h>authdes_createauthdes_pk_createauthnone_createauthunix_createauthunix_create_defaultgetnetnamehost2netnamekey_decryptsessionkey_decryptsession_pkkey_encryptsessionkey_encryptsession_pkkey_gendeskey_get_convkey_secretkey_is_setkey_setsecretnetname2hostnetname2useruser2netnamexdr_des_blockxdr_opaque_auth
Next: authdes_pk_create, Up: Glibc <rpc/auth.h> [Contents][Index]
authdes_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: authnone_create, Previous: authdes_create, Up: Glibc <rpc/auth.h> [Contents][Index]
authdes_pk_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: authunix_create, Previous: authdes_pk_create, Up: Glibc <rpc/auth.h> [Contents][Index]
authnone_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: authunix_create_default, Previous: authnone_create, Up: Glibc <rpc/auth.h> [Contents][Index]
authunix_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getnetname, Previous: authunix_create, Up: Glibc <rpc/auth.h> [Contents][Index]
authunix_create_defaultGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: host2netname, Previous: authunix_create_default, Up: Glibc <rpc/auth.h> [Contents][Index]
getnetnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_decryptsession, Previous: getnetname, Up: Glibc <rpc/auth.h> [Contents][Index]
host2netnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_decryptsession_pk, Previous: host2netname, Up: Glibc <rpc/auth.h> [Contents][Index]
key_decryptsessionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_encryptsession, Previous: key_decryptsession, Up: Glibc <rpc/auth.h> [Contents][Index]
key_decryptsession_pkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_encryptsession_pk, Previous: key_decryptsession_pk, Up: Glibc <rpc/auth.h> [Contents][Index]
key_encryptsessionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_gendes, Previous: key_encryptsession, Up: Glibc <rpc/auth.h> [Contents][Index]
key_encryptsession_pkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_get_conv, Previous: key_encryptsession_pk, Up: Glibc <rpc/auth.h> [Contents][Index]
key_gendesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_secretkey_is_set, Previous: key_gendes, Up: Glibc <rpc/auth.h> [Contents][Index]
key_get_convGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: key_setsecret, Previous: key_get_conv, Up: Glibc <rpc/auth.h> [Contents][Index]
key_secretkey_is_setGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: netname2host, Previous: key_secretkey_is_set, Up: Glibc <rpc/auth.h> [Contents][Index]
key_setsecretGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: netname2user, Previous: key_setsecret, Up: Glibc <rpc/auth.h> [Contents][Index]
netname2hostGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: user2netname, Previous: netname2host, Up: Glibc <rpc/auth.h> [Contents][Index]
netname2userGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_des_block, Previous: netname2user, Up: Glibc <rpc/auth.h> [Contents][Index]
user2netnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_opaque_auth, Previous: user2netname, Up: Glibc <rpc/auth.h> [Contents][Index]
xdr_des_blockGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_des_block, Up: Glibc <rpc/auth.h> [Contents][Index]
xdr_opaque_authGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/auth_unix.h>, Previous: Glibc <rpc/auth.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/auth_des.h>
Next: getpublickey, Up: Glibc <rpc/auth_des.h> [Contents][Index]
authdes_getucredGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getsecretkey, Previous: authdes_getucred, Up: Glibc <rpc/auth_des.h> [Contents][Index]
getpublickeyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rtime, Previous: getpublickey, Up: Glibc <rpc/auth_des.h> [Contents][Index]
getsecretkeyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getsecretkey, Up: Glibc <rpc/auth_des.h> [Contents][Index]
rtimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/clnt.h>, Previous: Glibc <rpc/auth_des.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/auth_unix.h>
Up: Glibc <rpc/auth_unix.h> [Contents][Index]
xdr_authunix_parmsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/des_crypt.h>, Previous: Glibc <rpc/auth_unix.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/clnt.h>callrpcclnt_createclnt_pcreateerrorclnt_perrnoclnt_perrorclnt_spcreateerrorclnt_sperrnoclnt_sperrorclntraw_createclnttcp_createclntudp_bufcreateclntudp_createclntunix_createget_myaddressgetrpcportrpc_createerr
Next: clnt_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
callrpcGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_pcreateerror, Previous: callrpc, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_perrno, Previous: clnt_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_pcreateerrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_perror, Previous: clnt_pcreateerror, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_perrnoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_spcreateerror, Previous: clnt_perrno, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_perrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_sperrno, Previous: clnt_perror, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_spcreateerrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnt_sperror, Previous: clnt_spcreateerror, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_sperrnoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clntraw_create, Previous: clnt_sperrno, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnt_sperrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clnttcp_create, Previous: clnt_sperror, Up: Glibc <rpc/clnt.h> [Contents][Index]
clntraw_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clntudp_bufcreate, Previous: clntraw_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
clnttcp_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clntudp_create, Previous: clnttcp_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
clntudp_bufcreateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clntunix_create, Previous: clntudp_bufcreate, Up: Glibc <rpc/clnt.h> [Contents][Index]
clntudp_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: get_myaddress, Previous: clntudp_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
clntunix_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcport, Previous: clntunix_create, Up: Glibc <rpc/clnt.h> [Contents][Index]
get_myaddressGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rpc_createerr, Previous: get_myaddress, Up: Glibc <rpc/clnt.h> [Contents][Index]
getrpcportGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getrpcport, Up: Glibc <rpc/clnt.h> [Contents][Index]
rpc_createerrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/key_prot.h>, Previous: Glibc <rpc/clnt.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/des_crypt.h>
Next: des_setparity, Up: Glibc <rpc/des_crypt.h> [Contents][Index]
cbc_cryptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ecb_crypt, Previous: cbc_crypt, Up: Glibc <rpc/des_crypt.h> [Contents][Index]
des_setparityGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: des_setparity, Up: Glibc <rpc/des_crypt.h> [Contents][Index]
ecb_cryptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/netdb.h>, Previous: Glibc <rpc/des_crypt.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/key_prot.h>xdr_cryptkeyargxdr_cryptkeyarg2xdr_cryptkeyresxdr_getcredresxdr_key_netstargxdr_key_netstresxdr_keybufxdr_keystatusxdr_netnamestrxdr_unixcred
Next: xdr_cryptkeyarg2, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_cryptkeyargGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_cryptkeyres, Previous: xdr_cryptkeyarg, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_cryptkeyarg2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_getcredres, Previous: xdr_cryptkeyarg2, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_cryptkeyresGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_key_netstarg, Previous: xdr_cryptkeyres, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_getcredresGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_key_netstres, Previous: xdr_getcredres, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_key_netstargGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_keybuf, Previous: xdr_key_netstarg, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_key_netstresGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_keystatus, Previous: xdr_key_netstres, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_keybufGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_netnamestr, Previous: xdr_keybuf, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_keystatusGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_unixcred, Previous: xdr_keystatus, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_netnamestrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_netnamestr, Up: Glibc <rpc/key_prot.h> [Contents][Index]
xdr_unixcredGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/pmap_clnt.h>, Previous: Glibc <rpc/key_prot.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/netdb.h>endrpcentgetrpcbynamegetrpcbyname_rgetrpcbynumbergetrpcbynumber_rgetrpcentgetrpcent_rsetrpcent
Next: getrpcbyname, Up: Glibc <rpc/netdb.h> [Contents][Index]
endrpcentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcbyname_r, Previous: endrpcent, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcbynameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcbynumber, Previous: getrpcbyname, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcbyname_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcbynumber_r, Previous: getrpcbyname_r, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcbynumberGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcent, Previous: getrpcbynumber, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcbynumber_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getrpcent_r, Previous: getrpcbynumber_r, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setrpcent, Previous: getrpcent, Up: Glibc <rpc/netdb.h> [Contents][Index]
getrpcent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getrpcent_r, Up: Glibc <rpc/netdb.h> [Contents][Index]
setrpcentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/pmap_prot.h>, Previous: Glibc <rpc/netdb.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/pmap_clnt.h>
Next: pmap_getmaps, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
clnt_broadcastGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pmap_getport, Previous: clnt_broadcast, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
pmap_getmapsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pmap_rmtcall, Previous: pmap_getmaps, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
pmap_getportGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pmap_set, Previous: pmap_getport, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
pmap_rmtcallGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pmap_unset, Previous: pmap_rmtcall, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
pmap_setGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: pmap_set, Up: Glibc <rpc/pmap_clnt.h> [Contents][Index]
pmap_unsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/pmap_rmt.h>, Previous: Glibc <rpc/pmap_clnt.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/pmap_prot.h>
Next: xdr_pmaplist, Up: Glibc <rpc/pmap_prot.h> [Contents][Index]
xdr_pmapGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_pmap, Up: Glibc <rpc/pmap_prot.h> [Contents][Index]
xdr_pmaplistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/rpc_msg.h>, Previous: Glibc <rpc/pmap_prot.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/pmap_rmt.h>
Next: xdr_rmtcallres, Up: Glibc <rpc/pmap_rmt.h> [Contents][Index]
xdr_rmtcall_argsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_rmtcall_args, Up: Glibc <rpc/pmap_rmt.h> [Contents][Index]
xdr_rmtcallresGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/svc.h>, Previous: Glibc <rpc/pmap_rmt.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/rpc_msg.h>
Next: xdr_callmsg, Up: Glibc <rpc/rpc_msg.h> [Contents][Index]
xdr_callhdrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_replymsg, Previous: xdr_callhdr, Up: Glibc <rpc/rpc_msg.h> [Contents][Index]
xdr_callmsgGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_callmsg, Up: Glibc <rpc/rpc_msg.h> [Contents][Index]
xdr_replymsgGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpc/xdr.h>, Previous: Glibc <rpc/rpc_msg.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/svc.h>svc_exitsvc_fdsetsvc_getreqsvc_getreq_commonsvc_getreq_pollsvc_getreqsetsvc_max_pollfdsvc_pollfdsvc_registersvc_runsvc_sendreplysvc_unregistersvcerr_authsvcerr_decodesvcerr_noprocsvcerr_noprogsvcerr_progverssvcerr_systemerrsvcerr_weakauthsvcraw_createsvctcp_createsvcudp_bufcreatesvcudp_createsvcunix_createxprt_registerxprt_unregister
Next: svc_fdset, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_exitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_getreq, Previous: svc_exit, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_fdsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_getreq_common, Previous: svc_fdset, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_getreqGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_getreq_poll, Previous: svc_getreq, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_getreq_commonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_getreqset, Previous: svc_getreq_common, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_getreq_pollGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_max_pollfd, Previous: svc_getreq_poll, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_getreqsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_pollfd, Previous: svc_getreqset, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_max_pollfdGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_register, Previous: svc_max_pollfd, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_pollfdGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_run, Previous: svc_pollfd, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_registerGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_sendreply, Previous: svc_register, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_runGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svc_unregister, Previous: svc_run, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_sendreplyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_auth, Previous: svc_sendreply, Up: Glibc <rpc/svc.h> [Contents][Index]
svc_unregisterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_decode, Previous: svc_unregister, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_authGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_noproc, Previous: svcerr_auth, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_decodeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_noprog, Previous: svcerr_decode, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_noprocGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_progvers, Previous: svcerr_noproc, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_noprogGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_systemerr, Previous: svcerr_noprog, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_progversGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcerr_weakauth, Previous: svcerr_progvers, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_systemerrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcraw_create, Previous: svcerr_systemerr, Up: Glibc <rpc/svc.h> [Contents][Index]
svcerr_weakauthGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svctcp_create, Previous: svcerr_weakauth, Up: Glibc <rpc/svc.h> [Contents][Index]
svcraw_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcudp_bufcreate, Previous: svcraw_create, Up: Glibc <rpc/svc.h> [Contents][Index]
svctcp_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcudp_create, Previous: svctcp_create, Up: Glibc <rpc/svc.h> [Contents][Index]
svcudp_bufcreateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: svcunix_create, Previous: svcudp_bufcreate, Up: Glibc <rpc/svc.h> [Contents][Index]
svcudp_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xprt_register, Previous: svcudp_create, Up: Glibc <rpc/svc.h> [Contents][Index]
svcunix_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xprt_unregister, Previous: svcunix_create, Up: Glibc <rpc/svc.h> [Contents][Index]
xprt_registerGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xprt_register, Up: Glibc <rpc/svc.h> [Contents][Index]
xprt_unregisterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/nislib.h>, Previous: Glibc <rpc/svc.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpc/xdr.h>xdr_arrayxdr_boolxdr_bytesxdr_charxdr_doublexdr_enumxdr_floatxdr_freexdr_hyperxdr_intxdr_int16_txdr_int32_txdr_int64_txdr_int8_txdr_longxdr_longlong_txdr_netobjxdr_opaquexdr_pointerxdr_quad_txdr_referencexdr_shortxdr_sizeofxdr_stringxdr_u_charxdr_u_hyperxdr_u_intxdr_u_longxdr_u_longlong_txdr_u_quad_txdr_u_shortxdr_uint16_txdr_uint32_txdr_uint64_txdr_uint8_txdr_unionxdr_vectorxdr_voidxdr_wrapstringxdrmem_createxdrrec_createxdrrec_endofrecordxdrrec_eofxdrrec_skiprecordxdrstdio_create
Next: xdr_bool, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_arrayGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_bytes, Previous: xdr_array, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_boolGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_char, Previous: xdr_bool, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_bytesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_double, Previous: xdr_bytes, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_charGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_enum, Previous: xdr_char, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_doubleGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_float, Previous: xdr_double, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_enumGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_free, Previous: xdr_enum, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_floatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_hyper, Previous: xdr_float, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_freeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_int, Previous: xdr_free, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_hyperGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_int16_t, Previous: xdr_hyper, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_intGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_int32_t, Previous: xdr_int, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_int16_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_int64_t, Previous: xdr_int16_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_int32_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_int8_t, Previous: xdr_int32_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_int64_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_long, Previous: xdr_int64_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_int8_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_longlong_t, Previous: xdr_int8_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_longGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_netobj, Previous: xdr_long, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_longlong_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_opaque, Previous: xdr_longlong_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_netobjGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_pointer, Previous: xdr_netobj, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_opaqueGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_quad_t, Previous: xdr_opaque, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_pointerGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_reference, Previous: xdr_pointer, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_quad_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_short, Previous: xdr_quad_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_referenceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_sizeof, Previous: xdr_reference, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_shortGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_string, Previous: xdr_short, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_sizeofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_char, Previous: xdr_sizeof, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_stringGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_hyper, Previous: xdr_string, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_charGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_int, Previous: xdr_u_char, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_hyperGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_long, Previous: xdr_u_hyper, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_intGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_longlong_t, Previous: xdr_u_int, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_longGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_quad_t, Previous: xdr_u_long, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_longlong_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_u_short, Previous: xdr_u_longlong_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_quad_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_uint16_t, Previous: xdr_u_quad_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_u_shortGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_uint32_t, Previous: xdr_u_short, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_uint16_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_uint64_t, Previous: xdr_uint16_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_uint32_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_uint8_t, Previous: xdr_uint32_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_uint64_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_union, Previous: xdr_uint64_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_uint8_tGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_vector, Previous: xdr_uint8_t, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_unionGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_void, Previous: xdr_union, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_vectorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_wrapstring, Previous: xdr_vector, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_voidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrmem_create, Previous: xdr_void, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdr_wrapstringGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrrec_create, Previous: xdr_wrapstring, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrmem_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrrec_endofrecord, Previous: xdrmem_create, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrrec_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrrec_eof, Previous: xdrrec_create, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrrec_endofrecordGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrrec_skiprecord, Previous: xdrrec_endofrecord, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrrec_eofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdrstdio_create, Previous: xdrrec_eof, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrrec_skiprecordGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdrrec_skiprecord, Up: Glibc <rpc/xdr.h> [Contents][Index]
xdrstdio_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/nis_callback.h>, Previous: Glibc <rpc/xdr.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/nislib.h>nis_addnis_add_entrynis_addmembernis_checkpointnis_clone_objectnis_creategroupnis_destroy_objectnis_destroygroupnis_dir_cmpnis_domain_ofnis_domain_of_rnis_first_entrynis_freenamesnis_freeresultnis_freeservlistnis_freetagsnis_getnamesnis_getservlistnis_ismembernis_leaf_ofnis_leaf_of_rnis_lerrornis_listnis_local_directorynis_local_groupnis_local_hostnis_local_principalnis_lookupnis_mkdirnis_modifynis_modify_entrynis_name_ofnis_name_of_rnis_next_entrynis_perrornis_pingnis_print_directorynis_print_entrynis_print_groupnis_print_group_entrynis_print_linknis_print_objectnis_print_resultnis_print_rightsnis_print_tablenis_removenis_remove_entrynis_removemembernis_rmdirnis_servstatenis_sperrnonis_sperrornis_sperror_rnis_statsnis_verifygroup
Next: nis_add_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_addGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_addmember, Previous: nis_add, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_add_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_checkpoint, Previous: nis_add_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_addmemberGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_clone_object, Previous: nis_addmember, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_checkpointGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_creategroup, Previous: nis_checkpoint, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_clone_objectGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_destroy_object, Previous: nis_clone_object, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_creategroupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_destroygroup, Previous: nis_creategroup, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_destroy_objectGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_dir_cmp, Previous: nis_destroy_object, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_destroygroupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_domain_of, Previous: nis_destroygroup, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_dir_cmpGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_domain_of_r, Previous: nis_dir_cmp, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_domain_ofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_first_entry, Previous: nis_domain_of, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_domain_of_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_freenames, Previous: nis_domain_of_r, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_first_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_freeresult, Previous: nis_first_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_freenamesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_freeservlist, Previous: nis_freenames, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_freeresultGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_freetags, Previous: nis_freeresult, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_freeservlistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_getnames, Previous: nis_freeservlist, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_freetagsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_getservlist, Previous: nis_freetags, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_getnamesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_ismember, Previous: nis_getnames, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_getservlistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_leaf_of, Previous: nis_getservlist, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_ismemberGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_leaf_of_r, Previous: nis_ismember, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_leaf_ofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_lerror, Previous: nis_leaf_of, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_leaf_of_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_list, Previous: nis_leaf_of_r, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_lerrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_local_directory, Previous: nis_lerror, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_listGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_local_group, Previous: nis_list, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_local_directoryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_local_host, Previous: nis_local_directory, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_local_groupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_local_principal, Previous: nis_local_group, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_local_hostGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_lookup, Previous: nis_local_host, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_local_principalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_mkdir, Previous: nis_local_principal, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_lookupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_modify, Previous: nis_lookup, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_mkdirGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_modify_entry, Previous: nis_mkdir, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_modifyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_name_of, Previous: nis_modify, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_modify_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_name_of_r, Previous: nis_modify_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_name_ofGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_next_entry, Previous: nis_name_of, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_name_of_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_perror, Previous: nis_name_of_r, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_next_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_ping, Previous: nis_next_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_perrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_directory, Previous: nis_perror, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_pingGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_entry, Previous: nis_ping, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_directoryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_group, Previous: nis_print_directory, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_group_entry, Previous: nis_print_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_groupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_link, Previous: nis_print_group, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_group_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_object, Previous: nis_print_group_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_linkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_result, Previous: nis_print_link, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_objectGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_rights, Previous: nis_print_object, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_resultGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_print_table, Previous: nis_print_result, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_rightsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_remove, Previous: nis_print_rights, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_print_tableGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_remove_entry, Previous: nis_print_table, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_removeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_removemember, Previous: nis_remove, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_remove_entryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_rmdir, Previous: nis_remove_entry, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_removememberGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_servstate, Previous: nis_removemember, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_rmdirGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_sperrno, Previous: nis_rmdir, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_servstateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_sperror, Previous: nis_servstate, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_sperrnoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_sperror_r, Previous: nis_sperrno, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_sperrorGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_stats, Previous: nis_sperror, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_sperror_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nis_verifygroup, Previous: nis_sperror_r, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_statsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: nis_stats, Up: Glibc <rpcsvc/nislib.h> [Contents][Index]
nis_verifygroupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/yp.h>, Previous: Glibc <rpcsvc/nislib.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/nis_callback.h>
Next: xdr_obj_p, Up: Glibc <rpcsvc/nis_callback.h> [Contents][Index]
xdr_cback_dataGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_cback_data, Up: Glibc <rpcsvc/nis_callback.h> [Contents][Index]
xdr_obj_pGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/yp_prot.h>, Previous: Glibc <rpcsvc/nis_callback.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/yp.h>xdr_domainnamexdr_keydatxdr_mapnamexdr_peernamexdr_valdatxdr_ypbind_bindingxdr_ypbind_respxdr_ypbind_resptypexdr_ypbind_setdomxdr_ypmap_parmsxdr_ypmaplistxdr_yppush_statusxdr_yppushresp_xfrxdr_ypreq_keyxdr_ypreq_nokeyxdr_ypreq_xfrxdr_ypresp_allxdr_ypresp_key_valxdr_ypresp_maplistxdr_ypresp_masterxdr_ypresp_orderxdr_ypresp_valxdr_ypresp_xfrxdr_ypstatxdr_ypxfrstat
Next: xdr_keydat, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_domainnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_mapname, Previous: xdr_domainname, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_keydatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_peername, Previous: xdr_keydat, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_mapnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_valdat, Previous: xdr_mapname, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_peernameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypbind_binding, Previous: xdr_peername, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_valdatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypbind_resp, Previous: xdr_valdat, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypbind_bindingGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypbind_resptype, Previous: xdr_ypbind_binding, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypbind_respGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypbind_setdom, Previous: xdr_ypbind_resp, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypbind_resptypeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypmap_parms, Previous: xdr_ypbind_resptype, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypbind_setdomGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypmaplist, Previous: xdr_ypbind_setdom, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypmap_parmsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_yppush_status, Previous: xdr_ypmap_parms, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypmaplistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_yppushresp_xfr, Previous: xdr_ypmaplist, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_yppush_statusGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypreq_key, Previous: xdr_yppush_status, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_yppushresp_xfrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypreq_nokey, Previous: xdr_yppushresp_xfr, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypreq_keyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypreq_xfr, Previous: xdr_ypreq_key, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypreq_nokeyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_all, Previous: xdr_ypreq_nokey, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypreq_xfrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_key_val, Previous: xdr_ypreq_xfr, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_allGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_maplist, Previous: xdr_ypresp_all, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_key_valGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_master, Previous: xdr_ypresp_key_val, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_maplistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_order, Previous: xdr_ypresp_maplist, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_masterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_val, Previous: xdr_ypresp_master, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_orderGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypresp_xfr, Previous: xdr_ypresp_order, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_valGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypstat, Previous: xdr_ypresp_val, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypresp_xfrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypxfrstat, Previous: xdr_ypresp_xfr, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypstatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_ypstat, Up: Glibc <rpcsvc/yp.h> [Contents][Index]
xdr_ypxfrstatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/ypclnt.h>, Previous: Glibc <rpcsvc/yp.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/yp_prot.h>xdr_ypallGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <rpcsvc/ypupd.h>, Previous: Glibc <rpcsvc/yp_prot.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/ypclnt.h>yp_allyp_bindyp_firstyp_get_default_domainyp_masteryp_matchyp_nextyp_orderyp_unbindyp_updateypbinderr_stringyperr_stringypprot_err
Next: yp_bind, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_allGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_first, Previous: yp_all, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_bindGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_get_default_domain, Previous: yp_bind, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_firstGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_master, Previous: yp_first, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_get_default_domainGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_match, Previous: yp_get_default_domain, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_masterGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_next, Previous: yp_master, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_matchGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_order, Previous: yp_match, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_nextGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_unbind, Previous: yp_next, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_orderGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yp_update, Previous: yp_order, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_unbindGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ypbinderr_string, Previous: yp_unbind, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yp_updateGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: yperr_string, Previous: yp_update, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
ypbinderr_stringGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ypprot_err, Previous: ypbinderr_string, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
yperr_stringGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: yperr_string, Up: Glibc <rpcsvc/ypclnt.h> [Contents][Index]
ypprot_errGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sched.h>, Previous: Glibc <rpcsvc/ypclnt.h>, Up: Glibc Function Substitutes [Contents][Index]
<rpcsvc/ypupd.h>
Next: xdr_ypdelete_args, Up: Glibc <rpcsvc/ypupd.h> [Contents][Index]
xdr_yp_bufGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: xdr_ypupdate_args, Previous: xdr_yp_buf, Up: Glibc <rpcsvc/ypupd.h> [Contents][Index]
xdr_ypdelete_argsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: xdr_ypdelete_args, Up: Glibc <rpcsvc/ypupd.h> [Contents][Index]
xdr_ypupdate_argsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <search.h>, Previous: Glibc <rpcsvc/ypupd.h>, Up: Glibc Function Substitutes [Contents][Index]
<sched.h>
Next: sched_getaffinity, Up: Glibc Extensions to <sched.h> [Contents][Index]
cloneGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sched_setaffinity, Previous: clone, Up: Glibc Extensions to <sched.h> [Contents][Index]
sched_getaffinityGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setns, Previous: sched_getaffinity, Up: Glibc Extensions to <sched.h> [Contents][Index]
sched_setaffinityGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: sched_setaffinity, Up: Glibc Extensions to <sched.h> [Contents][Index]
setnsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <selinux/selinux.h>, Previous: Glibc Extensions to <sched.h>, Up: Glibc Function Substitutes [Contents][Index]
<search.h>
Next: hdestroy_r, Up: Glibc Extensions to <search.h> [Contents][Index]
hcreate_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: hsearch_r, Previous: hcreate_r, Up: Glibc Extensions to <search.h> [Contents][Index]
hdestroy_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tdestroy, Previous: hdestroy_r, Up: Glibc Extensions to <search.h> [Contents][Index]
hsearch_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: hsearch_r, Up: Glibc Extensions to <search.h> [Contents][Index]
tdestroyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <shadow.h>, Previous: Glibc Extensions to <search.h>, Up: Glibc Function Substitutes [Contents][Index]
<selinux/selinux.h>
Next: getfilecon, Up: Glibc Extensions to <selinux/selinux.h> [Contents][Index]
fgetfileconGnulib module: selinux-h
Portability problems fixed by Gnulib:
errno to ENOTSUP and returns ‘-1’.
fgetfilecon function that insulates the caller from API-nonconforming behavior.
Without this wrapper, fgetfilecon can return ‘0’ and set
the context pointer to NULL, and in another scenario can return
‘10’ and set the context pointer to ‘unlabeled’.
This wrapper returns ‘-1’ in each case and sets errno to
ENOTSUP and ENODATA respectively.
While the conditions that can provoke such behavior are rare, the
average caller does not handle them because the possibility of such
behavior is not documented.
Portability problems not fixed by Gnulib:
Next: lgetfilecon, Previous: fgetfilecon, Up: Glibc Extensions to <selinux/selinux.h> [Contents][Index]
getfileconGnulib module: selinux-h
Portability problems fixed by Gnulib:
errno to ENOTSUP and returns ‘-1’.
getfilecon function that insulates the caller from API-nonconforming behavior.
Without this wrapper, getfilecon can return ‘0’ and set
the context pointer to NULL, and in another scenario can return
‘10’ and set the context pointer to ‘unlabeled’.
This wrapper returns ‘-1’ in each case and sets errno to
ENOTSUP and ENODATA respectively.
While the conditions that can provoke such behavior are rare, the
average caller does not handle them because the possibility of such
behavior is not documented.
Portability problems not fixed by Gnulib:
Previous: getfilecon, Up: Glibc Extensions to <selinux/selinux.h> [Contents][Index]
lgetfileconGnulib module: selinux-h
Portability problems fixed by Gnulib:
errno to ENOTSUP and returns ‘-1’.
lgetfilecon function that insulates the caller from API-nonconforming behavior.
Without this wrapper, lgetfilecon can return ‘0’ and set
the context pointer to NULL, and in another scenario can return
‘10’ and set the context pointer to ‘unlabeled’.
This wrapper returns ‘-1’ in each case and sets errno to
ENOTSUP and ENODATA respectively.
While the conditions that can provoke such behavior are rare, the
average caller does not handle them because the possibility of such
behavior is not documented.
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <signal.h>, Previous: Glibc Extensions to <selinux/selinux.h>, Up: Glibc Function Substitutes [Contents][Index]
<shadow.h>endspentfgetspentfgetspent_rgetspentgetspent_rgetspnamgetspnam_rlckpwdfputspentsetspentsgetspentsgetspent_rulckpwdf
Next: fgetspent, Up: Glibc <shadow.h> [Contents][Index]
endspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fgetspent_r, Previous: endspent, Up: Glibc <shadow.h> [Contents][Index]
fgetspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getspent, Previous: fgetspent, Up: Glibc <shadow.h> [Contents][Index]
fgetspent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getspent_r, Previous: fgetspent_r, Up: Glibc <shadow.h> [Contents][Index]
getspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getspnam, Previous: getspent, Up: Glibc <shadow.h> [Contents][Index]
getspent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getspnam_r, Previous: getspent_r, Up: Glibc <shadow.h> [Contents][Index]
getspnamGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lckpwdf, Previous: getspnam, Up: Glibc <shadow.h> [Contents][Index]
getspnam_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putspent, Previous: getspnam_r, Up: Glibc <shadow.h> [Contents][Index]
lckpwdfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setspent, Previous: lckpwdf, Up: Glibc <shadow.h> [Contents][Index]
putspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sgetspent, Previous: putspent, Up: Glibc <shadow.h> [Contents][Index]
setspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sgetspent_r, Previous: setspent, Up: Glibc <shadow.h> [Contents][Index]
sgetspentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ulckpwdf, Previous: sgetspent, Up: Glibc <shadow.h> [Contents][Index]
sgetspent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: sgetspent_r, Up: Glibc <shadow.h> [Contents][Index]
ulckpwdfGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <stdio.h>, Previous: Glibc <shadow.h>, Up: Glibc Function Substitutes [Contents][Index]
<signal.h>gsignalsigandsetsigblocksiggetmasksigisemptysetsigorsetsigreturnsigsetmasksigstacksigvecssignalsys_siglistsysv_signal
Next: sigandset, Up: Glibc Extensions to <signal.h> [Contents][Index]
gsignalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigblock, Previous: gsignal, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigandsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: siggetmask, Previous: sigandset, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigblockGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigisemptyset, Previous: sigblock, Up: Glibc Extensions to <signal.h> [Contents][Index]
siggetmaskGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigorset, Previous: siggetmask, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigisemptysetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigreturn, Previous: sigisemptyset, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigorsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigsetmask, Previous: sigorset, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigreturnGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigstack, Previous: sigreturn, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigsetmaskGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sigvec, Previous: sigsetmask, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigstackGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ssignal, Previous: sigstack, Up: Glibc Extensions to <signal.h> [Contents][Index]
sigvecGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys_siglist, Previous: sigvec, Up: Glibc Extensions to <signal.h> [Contents][Index]
ssignalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sysv_signal, Previous: ssignal, Up: Glibc Extensions to <signal.h> [Contents][Index]
sys_siglistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: sys_siglist, Up: Glibc Extensions to <signal.h> [Contents][Index]
sysv_signalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <stdlib.h>, Previous: Glibc Extensions to <signal.h>, Up: Glibc Function Substitutes [Contents][Index]
<stdio.h>asprintfcuseridclearerr_unlockedfcloseallfeof_unlockedferror_unlockedfflush_unlockedfgetc_unlockedfgets_unlockedfileno_unlockedfopencookiefputc_unlockedfputs_unlockedfread_unlockedfwrite_unlockedgetwputwsetbuffersetlinebufsys_errlistsys_nerrtmpnam_rvasprintf
Next: cuserid, Up: Glibc Extensions to <stdio.h> [Contents][Index]
asprintfGnulib module: vasprintf or vasprintf-posix
Portability problems fixed by either Gnulib module vasprintf or vasprintf-posix:
Portability problems fixed by Gnulib module vasprintf-posix:
hh, ll,
j, t, z) on some platforms:
Cygwin 1.5.24, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
Solaris 11.0.
"%2$s", on some platforms:
NetBSD 3.0, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, Solaris 11.0, Cygwin 1.5.x.
Portability problems not fixed by Gnulib:
Next: clearerr_unlocked, Previous: asprintf, Up: Glibc Extensions to <stdio.h> [Contents][Index]
cuseridGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fcloseall, Previous: cuserid, Up: Glibc Extensions to <stdio.h> [Contents][Index]
clearerr_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: feof_unlocked, Previous: clearerr_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fcloseallGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ferror_unlocked, Previous: fcloseall, Up: Glibc Extensions to <stdio.h> [Contents][Index]
feof_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fflush_unlocked, Previous: feof_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
ferror_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fgetc_unlocked, Previous: ferror_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fflush_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fgets_unlocked, Previous: fflush_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fgetc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fileno_unlocked, Previous: fgetc_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fgets_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fopencookie, Previous: fgets_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fileno_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fputc_unlocked, Previous: fileno_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fopencookieGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fputs_unlocked, Previous: fopencookie, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fputc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fread_unlocked, Previous: fputc_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fputs_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fwrite_unlocked, Previous: fputs_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fread_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getw, Previous: fread_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
fwrite_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: putw, Previous: fwrite_unlocked, Up: Glibc Extensions to <stdio.h> [Contents][Index]
getwGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setbuffer, Previous: getw, Up: Glibc Extensions to <stdio.h> [Contents][Index]
putwGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setlinebuf, Previous: putw, Up: Glibc Extensions to <stdio.h> [Contents][Index]
setbufferGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys_errlist, Previous: setbuffer, Up: Glibc Extensions to <stdio.h> [Contents][Index]
setlinebufGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sys_nerr, Previous: setlinebuf, Up: Glibc Extensions to <stdio.h> [Contents][Index]
sys_errlistGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: tmpnam_r, Previous: sys_errlist, Up: Glibc Extensions to <stdio.h> [Contents][Index]
sys_nerrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vasprintf, Previous: sys_nerr, Up: Glibc Extensions to <stdio.h> [Contents][Index]
tmpnam_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: tmpnam_r, Up: Glibc Extensions to <stdio.h> [Contents][Index]
vasprintfGnulib module: vasprintf or vasprintf-posix
Portability problems fixed by either Gnulib module vasprintf or vasprintf-posix:
Portability problems fixed by Gnulib module vasprintf-posix:
hh, ll,
j, t, z) on some platforms:
Cygwin 1.5.24, BeOS.
"%f", "%e", "%g" of Infinity and NaN yields an
incorrect result on some platforms:
Solaris 11.0.
"%2$s", on some platforms:
NetBSD 3.0, BeOS.
' flag on some platforms:
NetBSD 3.0, Cygwin 1.5.24.
"%010f" of NaN and Infinity yields an incorrect result (padded
with zeroes) on some platforms:
Mac OS X 10.5, FreeBSD 6.0, NetBSD 5.0, Solaris 11.0, Cygwin 1.5.x.
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <string.h>, Previous: Glibc Extensions to <stdio.h>, Up: Glibc Function Substitutes [Contents][Index]
<stdlib.h>canonicalize_file_namecfreeclearenvdrand48_recvt_rerand48_rfcvt_rgetloadavggetptinitstate_rjrand48_rlcong48_rlrand48_rmkostempmkostempsmrand48_rmkstempsnrand48_ron_exitptsname_rqecvtqecvt_rqfcvtqfcvt_rqgcvtqsort_rrandom_rrpmatchsecure_getenvseed48_rsetstate_rsrand48_rsrandom_rstrtod_lstrtof_lstrtol_lstrtold_lstrtoll_lstrtoqstrtoul_lstrtoull_lstrtouqvalloc
Next: cfree, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
canonicalize_file_nameGnulib module: canonicalize-lgpl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: clearenv, Previous: canonicalize_file_name, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
cfreeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: drand48_r, Previous: cfree, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
clearenvGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ecvt_r, Previous: clearenv, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
drand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: erand48_r, Previous: drand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
ecvt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fcvt_r, Previous: ecvt_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
erand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getloadavg, Previous: erand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
fcvt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getpt, Previous: fcvt_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
getloadavgGnulib module: getloadavg
Portability problems fixed by Gnulib:
<sys/loadavg.h>, not <stdlib.h>,
on some platforms:
Solaris 11.3.
Portability problems not fixed by Gnulib:
Next: initstate_r, Previous: getloadavg, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
getptGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: jrand48_r, Previous: getpt, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
initstate_rGnulib module: random_r
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lcong48_r, Previous: initstate_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
jrand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lrand48_r, Previous: jrand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
lcong48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkostemp, Previous: lcong48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
lrand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mkostemps, Previous: lrand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
mkostempGnulib module: mkostemp
Portability problems fixed by Gnulib:
off_t is a 32-bit type, mkostemp may not work
correctly to create files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
The gnulib module clean-temp can create temporary files that will not
be left behind after signals such as SIGINT.
Next: mrand48_r, Previous: mkostemp, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
mkostempsGnulib module: mkostemps
Portability problems fixed by Gnulib:
off_t is a 32-bit type, mkostemps may not work
correctly to create files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
The gnulib module clean-temp can create temporary files that will not
be left behind after signals such as SIGINT.
Next: mkstemps, Previous: mkostemps, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
mrand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: nrand48_r, Previous: mrand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
mkstempsGnulib module: mkstemps
Portability problems fixed by Gnulib:
<unistd.h> instead of <stdlib.h>
on some platforms:
Mac OS X 10.5.
off_t is a 32-bit type, mkstemps may not work
correctly to create files larger than 2 GB. (Cf. AC_SYS_LARGEFILE.)
Portability problems not fixed by Gnulib:
The gnulib module clean-temp can create temporary files that will not
be left behind after signals such as SIGINT.
Next: on_exit, Previous: mkstemps, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
nrand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ptsname_r, Previous: nrand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
on_exitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: qecvt, Previous: on_exit, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
ptsname_rGnulib module: ptsname_r
Portability problems fixed by Gnulib:
_REENTRANT is defined,
on some platforms:
OSF/1 5.1.
Portability problems not fixed by Gnulib:
errno, on some platforms:
musl libc.
Next: qecvt_r, Previous: ptsname_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qecvtGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: qfcvt, Previous: qecvt, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qecvt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: qfcvt_r, Previous: qecvt_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qfcvtGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: qgcvt, Previous: qfcvt, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qfcvt_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: qsort_r, Previous: qfcvt_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qgcvtGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: random_r, Previous: qgcvt, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
qsort_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rpmatch, Previous: qsort_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
random_rGnulib module: random_r
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: secure_getenv, Previous: random_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
rpmatchGnulib module: rpmatch
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: seed48_r, Previous: rpmatch, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
secure_getenvGnulib module: secure_getenv
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setstate_r, Previous: secure_getenv, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
seed48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: srand48_r, Previous: seed48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
setstate_rGnulib module: random_r
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: srandom_r, Previous: setstate_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
srand48_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtod_l, Previous: srand48_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
srandom_rGnulib module: random_r
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtof_l, Previous: srandom_r, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtod_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtol_l, Previous: strtod_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtof_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtold_l, Previous: strtof_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtol_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoll_l, Previous: strtol_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtold_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoq, Previous: strtold_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtoll_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoul_l, Previous: strtoll_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtoqGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtoull_l, Previous: strtoq, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtoul_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strtouq, Previous: strtoul_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtoull_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: valloc, Previous: strtoull_l, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
strtouqGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: strtouq, Up: Glibc Extensions to <stdlib.h> [Contents][Index]
vallocGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/capability.h>, Previous: Glibc Extensions to <stdlib.h>, Up: Glibc Function Substitutes [Contents][Index]
<string.h>explicit_bzeroffslffsllmemfrobmemmemmempcpymemrchrrawmemchrstrcasestrstrchrnulstrfrystrsepstrverscmp
Next: ffsl, Up: Glibc Extensions to <string.h> [Contents][Index]
explicit_bzeroGnulib module: explicit_bzero
The explicit_bzero function is an approximation to what is
needed, and does not suffice in general to erase information.
Although calling explicit_bzero should clear the memory in
question, the information that was in memory may still be available
elsewhere on the machine. Proper implementation of information
erasure requires support from levels below C code.
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ffsll, Previous: explicit_bzero, Up: Glibc Extensions to <string.h> [Contents][Index]
ffslGnulib module: ffsl
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memfrob, Previous: ffsl, Up: Glibc Extensions to <string.h> [Contents][Index]
ffsllGnulib module: ffsll
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: memmem, Previous: ffsll, Up: Glibc Extensions to <string.h> [Contents][Index]
memfrobGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mempcpy, Previous: memfrob, Up: Glibc Extensions to <string.h> [Contents][Index]
memmemGnulib module: memmem or memmem-simple
Both modules implement the same replacement for the memmem function
with the memmem module providing a replacement on more platforms where
the existing memmem function has a quadratic worst-case complexity.
Portability problems fixed by either Gnulib module memmem-simple
or memmem:
Performance problems fixed by Gnulib module memmem:
Portability problems not fixed by Gnulib:
Next: memrchr, Previous: memmem, Up: Glibc Extensions to <string.h> [Contents][Index]
mempcpyGnulib module: mempcpy
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: rawmemchr, Previous: mempcpy, Up: Glibc Extensions to <string.h> [Contents][Index]
memrchrGnulib module: memrchr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strcasestr, Previous: memrchr, Up: Glibc Extensions to <string.h> [Contents][Index]
rawmemchrGnulib module: rawmemchr
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strchrnul, Previous: rawmemchr, Up: Glibc Extensions to <string.h> [Contents][Index]
strcasestrGnulib module: strcasestr or strcasestr-simple
Portability problems fixed by either Gnulib module strcasestr-simple
or strcasestr:
Portability problems fixed by Gnulib module strcasestr:
Portability problems not fixed by Gnulib:
Next: strfry, Previous: strcasestr, Up: Glibc Extensions to <string.h> [Contents][Index]
strchrnulGnulib module: strchrnul
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strsep, Previous: strchrnul, Up: Glibc Extensions to <string.h> [Contents][Index]
strfryGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strverscmp, Previous: strfry, Up: Glibc Extensions to <string.h> [Contents][Index]
strsepGnulib module: strsep
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: strsep, Up: Glibc Extensions to <string.h> [Contents][Index]
strverscmpGnulib module: strverscmp
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
strverscmp ("B0075022800016.gbp.corp.com",
"B007502357019.GBP.CORP.COM") does not yield a negative number as it
should):
glibc 2.9
Next: Glibc <sys/epoll.h>, Previous: Glibc Extensions to <string.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/capability.h>
Next: capset, Up: Glibc <sys/capability.h> [Contents][Index]
capgetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: capget, Up: Glibc <sys/capability.h> [Contents][Index]
capsetGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/fanotify.h>, Previous: Glibc <sys/capability.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/epoll.h>
Next: epoll_ctl, Up: Glibc <sys/epoll.h> [Contents][Index]
epoll_createGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: epoll_wait, Previous: epoll_create, Up: Glibc <sys/epoll.h> [Contents][Index]
epoll_ctlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: epoll_ctl, Up: Glibc <sys/epoll.h> [Contents][Index]
epoll_waitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/file.h>, Previous: Glibc <sys/epoll.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/fanotify.h>
Next: fanotify_mark, Up: Glibc <sys/fanotify.h> [Contents][Index]
fanotify_initGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: fanotify_init, Up: Glibc <sys/fanotify.h> [Contents][Index]
fanotify_markGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/fsuid.h>, Previous: Glibc <sys/fanotify.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/file.h>
Up: Glibc <sys/file.h> [Contents][Index]
flockGnulib module: flock
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/gmon.h>, Previous: Glibc <sys/file.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/fsuid.h>
Next: setfsuid, Up: Glibc <sys/fsuid.h> [Contents][Index]
setfsgidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: setfsgid, Up: Glibc <sys/fsuid.h> [Contents][Index]
setfsuidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/io.h>, <sys/perm.h>, Previous: Glibc <sys/fsuid.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/gmon.h>
Up: Glibc <sys/gmon.h> [Contents][Index]
monstartupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/kdaemon.h>, Previous: Glibc <sys/gmon.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/io.h>, <sys/perm.h>
Next: iopl, Up: Glibc <sys/io.h>, <sys/perm.h> [Contents][Index]
iopermGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ioperm, Up: Glibc <sys/io.h>, <sys/perm.h> [Contents][Index]
ioplGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/klog.h>, Previous: Glibc <sys/io.h>, <sys/perm.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/kdaemon.h>
Up: Glibc <sys/kdaemon.h> [Contents][Index]
bdflushGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/mman.h>, Previous: Glibc <sys/kdaemon.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/klog.h>
Up: Glibc <sys/klog.h> [Contents][Index]
klogctlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/mount.h>, Previous: Glibc <sys/klog.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/mman.h>
Next: mincore, Up: Glibc Extensions to <sys/mman.h> [Contents][Index]
madviseGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: mremap, Previous: madvise, Up: Glibc Extensions to <sys/mman.h> [Contents][Index]
mincoreGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: remap_file_pages, Previous: mincore, Up: Glibc Extensions to <sys/mman.h> [Contents][Index]
mremapGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: mremap, Up: Glibc Extensions to <sys/mman.h> [Contents][Index]
remap_file_pagesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/personality.h>, Previous: Glibc Extensions to <sys/mman.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/mount.h>
Next: umount, Up: Glibc <sys/mount.h> [Contents][Index]
mountGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: umount2, Previous: mount, Up: Glibc <sys/mount.h> [Contents][Index]
umountGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: umount, Up: Glibc <sys/mount.h> [Contents][Index]
umount2Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/prctl.h>, Previous: Glibc <sys/mount.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/personality.h>personalityGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/profil.h>, Previous: Glibc <sys/personality.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/prctl.h>
Up: Glibc <sys/prctl.h> [Contents][Index]
prctlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/ptrace.h>, Previous: Glibc <sys/prctl.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/profil.h>
Up: Glibc <sys/profil.h> [Contents][Index]
sprofilGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/quota.h>, Previous: Glibc <sys/profil.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/ptrace.h>
Up: Glibc <sys/ptrace.h> [Contents][Index]
ptraceGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/reboot.h>, Previous: Glibc <sys/ptrace.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/quota.h>
Up: Glibc <sys/quota.h> [Contents][Index]
quotactlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/resource.h>, Previous: Glibc <sys/quota.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/reboot.h>
Up: Glibc <sys/reboot.h> [Contents][Index]
rebootGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/sem.h>, Previous: Glibc <sys/reboot.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/resource.h>prlimitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/sendfile.h>, Previous: Glibc Extensions to <sys/resource.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/sem.h>semtimedopGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/socket.h>, Previous: Glibc Extensions to <sys/sem.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/sendfile.h>
Up: Glibc <sys/sendfile.h> [Contents][Index]
sendfileGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: Glibc Extensions to <sys/stat.h>, Previous: Glibc <sys/sendfile.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/socket.h>
Next: isfdtype, Up: Glibc Extensions to <sys/socket.h> [Contents][Index]
accept4Gnulib module: accept4
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: recvmmsg, Previous: accept4, Up: Glibc Extensions to <sys/socket.h> [Contents][Index]
isfdtypeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sendmmsg, Previous: isfdtype, Up: Glibc Extensions to <sys/socket.h> [Contents][Index]
recvmmsgGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: recvmmsg, Up: Glibc Extensions to <sys/socket.h> [Contents][Index]
sendmmsgGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/statfs.h>, Previous: Glibc Extensions to <sys/socket.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/stat.h>lchmodGnulib module: lchmod
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/swap.h>, Previous: Glibc Extensions to <sys/stat.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/statfs.h>
Next: statfs, Up: Glibc <sys/statfs.h> [Contents][Index]
fstatfsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
f_blocks in ‘struct statfs’ is a 32-bit
value, this function may not work correctly on files systems larger than
4 TiB. The fix is to use the AC_SYS_LARGEFILE macro. This affects
Mac OS X.
Previous: fstatfs, Up: Glibc <sys/statfs.h> [Contents][Index]
statfsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
f_blocks in ‘struct statfs’ is a 32-bit
value, this function may not work correctly on files systems larger than
4 TiB. The fix is to use the AC_SYS_LARGEFILE macro. This affects
Mac OS X.
Next: Glibc <sys/sysctl.h>, Previous: Glibc <sys/statfs.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/swap.h>
Next: swapon, Up: Glibc <sys/swap.h> [Contents][Index]
swapoffGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: swapoff, Up: Glibc <sys/swap.h> [Contents][Index]
swaponGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/sysinfo.h>, Previous: Glibc <sys/swap.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/sysctl.h>
Up: Glibc <sys/sysctl.h> [Contents][Index]
sysctlGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/syslog.h>, Previous: Glibc <sys/sysctl.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/sysinfo.h>
Next: get_nprocs, Up: Glibc <sys/sysinfo.h> [Contents][Index]
get_avphys_pagesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: get_nprocs_conf, Previous: get_avphys_pages, Up: Glibc <sys/sysinfo.h> [Contents][Index]
get_nprocsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Gnulib provides the module nproc that performs a similar
function but is portable to more systems.
Next: get_phys_pages, Previous: get_nprocs, Up: Glibc <sys/sysinfo.h> [Contents][Index]
get_nprocs_confGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sysinfo, Previous: get_nprocs_conf, Up: Glibc <sys/sysinfo.h> [Contents][Index]
get_phys_pagesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: get_phys_pages, Up: Glibc <sys/sysinfo.h> [Contents][Index]
sysinfoGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/sysmacros.h>, Previous: Glibc <sys/sysinfo.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/syslog.h>
Up: Glibc <sys/syslog.h> [Contents][Index]
vsyslogGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/time.h>, Previous: Glibc <sys/syslog.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/sysmacros.h>
Next: gnu_dev_makedev, Up: Glibc <sys/sysmacros.h> [Contents][Index]
gnu_dev_majorGnulib module: —
Portability problems fixed by Gnulib:
AC_HEADER_MAJOR macro in Autoconf 2.69 and earlier fails to
set MAJOR_IN_SYSMACROS when it detects namespace pollution in
sys/types.h; which in turn provokes deprecation warnings in
glibc 2.25.
Portability problems not fixed by Gnulib:
Next: gnu_dev_minor, Previous: gnu_dev_major, Up: Glibc <sys/sysmacros.h> [Contents][Index]
gnu_dev_makedevGnulib module: —
Portability problems fixed by Gnulib:
AC_HEADER_MAJOR macro in Autoconf 2.69 and earlier fails to
set MAJOR_IN_SYSMACROS when it detects namespace pollution in
sys/types.h; which in turn provokes deprecation warnings in
glibc 2.25.
Portability problems not fixed by Gnulib:
Previous: gnu_dev_makedev, Up: Glibc <sys/sysmacros.h> [Contents][Index]
gnu_dev_minorGnulib module: —
Portability problems fixed by Gnulib:
AC_HEADER_MAJOR macro in Autoconf 2.69 and earlier fails to
set MAJOR_IN_SYSMACROS when it detects namespace pollution in
sys/types.h; which in turn provokes deprecation warnings in
glibc 2.25.
Portability problems not fixed by Gnulib:
Next: Glibc <sys/timex.h>, Previous: Glibc <sys/sysmacros.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/time.h>
Next: futimes, Up: Glibc Extensions to <sys/time.h> [Contents][Index]
adjtimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: futimesat, Previous: adjtime, Up: Glibc Extensions to <sys/time.h> [Contents][Index]
futimesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
futimens(fd,times) instead.
Next: lutimes, Previous: futimes, Up: Glibc Extensions to <sys/time.h> [Contents][Index]
futimesatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
file ? utimensat(fd,file,times,0) : futimens(fd,times), or the
gnulib module fdutimensat, instead.
Next: settimeofday, Previous: futimesat, Up: Glibc Extensions to <sys/time.h> [Contents][Index]
lutimesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
utimensat(AT_FDCWD,file,times,AT_SYMLINK_NOFOLLOW), or the
gnulib module utimens, instead.
lstat modifies the access time of
symlinks on some platforms, so lutimes can only effectively
change modification time:
Cygwin.
Previous: lutimes, Up: Glibc Extensions to <sys/time.h> [Contents][Index]
settimeofdayGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/uio.h>, Previous: Glibc Extensions to <sys/time.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/timex.h>
Next: ntp_adjtime, Up: Glibc <sys/timex.h> [Contents][Index]
adjtimexGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ntp_gettime, Previous: adjtimex, Up: Glibc <sys/timex.h> [Contents][Index]
ntp_adjtimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ntp_gettimex, Previous: ntp_adjtime, Up: Glibc <sys/timex.h> [Contents][Index]
ntp_gettimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ntp_gettime, Up: Glibc <sys/timex.h> [Contents][Index]
ntp_gettimexGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/ustat.h>, Previous: Glibc <sys/timex.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/uio.h>
Next: process_vm_readv, Up: Glibc Extensions to <sys/uio.h> [Contents][Index]
preadvGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: process_vm_writev, Previous: preadv, Up: Glibc Extensions to <sys/uio.h> [Contents][Index]
process_vm_readvGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pwritev, Previous: process_vm_readv, Up: Glibc Extensions to <sys/uio.h> [Contents][Index]
process_vm_writevGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: process_vm_writev, Up: Glibc Extensions to <sys/uio.h> [Contents][Index]
pwritevGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
off_t is a 32-bit type, this function may not
work correctly on files larger than 2 GB. The fix is to use the
AC_SYS_LARGEFILE macro.
Next: Glibc <sys/vlimit.h>, Previous: Glibc Extensions to <sys/uio.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/ustat.h>
Up: Glibc <sys/ustat.h> [Contents][Index]
ustatGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/vm86.h>, Previous: Glibc <sys/ustat.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/vlimit.h>
Up: Glibc <sys/vlimit.h> [Contents][Index]
vlimitGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/vtimes.h>, Previous: Glibc <sys/vlimit.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/vm86.h>
Up: Glibc <sys/vm86.h> [Contents][Index]
vm86Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <sys/wait.h>, Previous: Glibc <sys/vm86.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/vtimes.h>
Up: Glibc <sys/vtimes.h> [Contents][Index]
vtimesGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <sys/xattr.h>, Previous: Glibc <sys/vtimes.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/wait.h>
Next: wait4, Up: Glibc Extensions to <sys/wait.h> [Contents][Index]
wait3Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: wait3, Up: Glibc Extensions to <sys/wait.h> [Contents][Index]
wait4Gnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <termios.h>, Previous: Glibc Extensions to <sys/wait.h>, Up: Glibc Function Substitutes [Contents][Index]
<sys/xattr.h>fgetxattrflistxattrfremovexattrfsetxattrgetxattrlgetxattrlistxattrllistxattrlremovexattrlsetxattrremovexattrsetxattr
Next: flistxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
fgetxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
offset and options parameters:
Mac OS X 10.4
Next: fremovexattr, Previous: fgetxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
flistxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: fsetxattr, Previous: flistxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
fremovexattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getxattr, Previous: fremovexattr, Up: Glibc <sys/xattr.h> [Contents][Index]
fsetxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lgetxattr, Previous: fsetxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
getxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
offset and options parameters:
Mac OS X 10.4
Next: listxattr, Previous: getxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
lgetxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: llistxattr, Previous: lgetxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
listxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lremovexattr, Previous: listxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
llistxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: lsetxattr, Previous: llistxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
lremovexattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: removexattr, Previous: lremovexattr, Up: Glibc <sys/xattr.h> [Contents][Index]
lsetxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setxattr, Previous: lsetxattr, Up: Glibc <sys/xattr.h> [Contents][Index]
removexattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: removexattr, Up: Glibc <sys/xattr.h> [Contents][Index]
setxattrGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <time.h>, Previous: Glibc <sys/xattr.h>, Up: Glibc Function Substitutes [Contents][Index]
<termios.h>
Next: cfsetspeed, Up: Glibc Extensions to <termios.h> [Contents][Index]
cfmakerawGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: cfmakeraw, Up: Glibc Extensions to <termios.h> [Contents][Index]
cfsetspeedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <ttyent.h>, Previous: Glibc Extensions to <termios.h>, Up: Glibc Function Substitutes [Contents][Index]
<time.h>
Next: dysize, Up: Glibc Extensions to <time.h> [Contents][Index]
clock_adjtimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getdate_r, Previous: clock_adjtime, Up: Glibc Extensions to <time.h> [Contents][Index]
dysizeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: stime, Previous: dysize, Up: Glibc Extensions to <time.h> [Contents][Index]
getdate_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: strptime_l, Previous: getdate_r, Up: Glibc Extensions to <time.h> [Contents][Index]
stimeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timegm, Previous: stime, Up: Glibc Extensions to <time.h> [Contents][Index]
strptime_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timelocal, Previous: strptime_l, Up: Glibc Extensions to <time.h> [Contents][Index]
timegmGnulib module: timegm
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: timespec_get, Previous: timegm, Up: Glibc Extensions to <time.h> [Contents][Index]
timelocalGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: timelocal, Up: Glibc Extensions to <time.h> [Contents][Index]
timespec_getGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <unistd.h>, Previous: Glibc Extensions to <time.h>, Up: Glibc Function Substitutes [Contents][Index]
<ttyent.h>
Next: getttyent, Up: Glibc <ttyent.h> [Contents][Index]
endttyentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getttynam, Previous: endttyent, Up: Glibc <ttyent.h> [Contents][Index]
getttyentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setttyent, Previous: getttyent, Up: Glibc <ttyent.h> [Contents][Index]
getttynamGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: getttynam, Up: Glibc <ttyent.h> [Contents][Index]
setttyentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc <utmp.h>, Previous: Glibc <ttyent.h>, Up: Glibc Function Substitutes [Contents][Index]
<unistd.h>acctbrkchrootdaemondup3endusershelleuidaccessexecvpeget_current_dir_namegetdomainnamegetdtablesizegetpagesizegetpassgetresgidgetresuidgetusershellgroup_memberpipe2profilrevokesbrksetloginsetdomainnamesethostidsethostnamesetresgidsetresuidsetusershellsyncfssyscallttyslotvhangup
Next: brk, Up: Glibc Extensions to <unistd.h> [Contents][Index]
acctGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: chroot, Previous: acct, Up: Glibc Extensions to <unistd.h> [Contents][Index]
brkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: daemon, Previous: brk, Up: Glibc Extensions to <unistd.h> [Contents][Index]
chrootGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: dup3, Previous: chroot, Up: Glibc Extensions to <unistd.h> [Contents][Index]
daemonGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: endusershell, Previous: daemon, Up: Glibc Extensions to <unistd.h> [Contents][Index]
dup3Gnulib module: dup3
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: euidaccess, Previous: dup3, Up: Glibc Extensions to <unistd.h> [Contents][Index]
endusershellGnulib module: getusershell
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: execvpe, Previous: endusershell, Up: Glibc Extensions to <unistd.h> [Contents][Index]
euidaccessGnulib module: euidaccess
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Other problems of this function:
stat versus lstat). If you need this option, use
the Gnulib module faccessat with the AT_EACCESS flag.
Next: get_current_dir_name, Previous: euidaccess, Up: Glibc Extensions to <unistd.h> [Contents][Index]
execvpeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getdomainname, Previous: execvpe, Up: Glibc Extensions to <unistd.h> [Contents][Index]
get_current_dir_nameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getdtablesize, Previous: get_current_dir_name, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getdomainnameGnulib module: getdomainname
Portability problems fixed by Gnulib:
netdb.h, not in unistd.h, on
some platforms:
AIX 7.1.
netdb.h and in sys/socket.h, not
in unistd.h, on some platforms:
OSF/1 5.1.
int, not size_t, on some platforms:
Mac OS X 10.5, FreeBSD 6.4, AIX 7.1, IRIX 6.5.
Portability problems not fixed by Gnulib:
Next: getpagesize, Previous: getdomainname, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getdtablesizeSUSv2 specification: http://pubs.opengroup.org/onlinepubs/7908799/xsh/getdtablesize.html
Gnulib module: getdtablesize
Portability problems fixed by Gnulib:
RLIMIT_NOFILE soft
limit on some platforms:
Android LP32, Cygwin 1.7.25.
Portability problems not fixed by Gnulib:
Next: getpass, Previous: getdtablesize, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getpagesizeGnulib module: getpagesize
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getresgid, Previous: getpagesize, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getpassGnulib module: getpass or getpass-gnu
Portability problems fixed by either Gnulib module getpass or getpass-gnu:
Portability problems fixed by Gnulib module getpass-gnu:
Portability problems not fixed by Gnulib:
Next: getresuid, Previous: getpass, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getresgidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getusershell, Previous: getresgid, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getresuidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: group_member, Previous: getresuid, Up: Glibc Extensions to <unistd.h> [Contents][Index]
getusershellGnulib module: getusershell
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pipe2, Previous: getusershell, Up: Glibc Extensions to <unistd.h> [Contents][Index]
group_memberGnulib module: group-member
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: profil, Previous: group_member, Up: Glibc Extensions to <unistd.h> [Contents][Index]
pipe2Gnulib module: pipe2
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
EMFILE if no
resources are left on some platforms:
Cygwin 1.7.9.
Note: This function portably supports the O_NONBLOCK flag only if the
gnulib module nonblocking is also used.
Next: revoke, Previous: pipe2, Up: Glibc Extensions to <unistd.h> [Contents][Index]
profilGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sbrk, Previous: profil, Up: Glibc Extensions to <unistd.h> [Contents][Index]
revokeGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setlogin, Previous: revoke, Up: Glibc Extensions to <unistd.h> [Contents][Index]
sbrkGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setdomainname, Previous: sbrk, Up: Glibc Extensions to <unistd.h> [Contents][Index]
setloginGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sethostid, Previous: setlogin, Up: Glibc Extensions to <unistd.h> [Contents][Index]
setdomainnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: sethostname, Previous: setdomainname, Up: Glibc Extensions to <unistd.h> [Contents][Index]
sethostidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setresgid, Previous: sethostid, Up: Glibc Extensions to <unistd.h> [Contents][Index]
sethostnameGnulib module: sethostname
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
char * instead of const char *
on some platforms: Solaris 11 2010-11.
int instead of size_t
on some platforms: Mac OS X 10.12, Solaris 11 2010-11.
Next: setresuid, Previous: sethostname, Up: Glibc Extensions to <unistd.h> [Contents][Index]
setresgidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setusershell, Previous: setresgid, Up: Glibc Extensions to <unistd.h> [Contents][Index]
setresuidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: syncfs, Previous: setresuid, Up: Glibc Extensions to <unistd.h> [Contents][Index]
setusershellGnulib module: getusershell
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: syscall, Previous: setusershell, Up: Glibc Extensions to <unistd.h> [Contents][Index]
syncfsGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: ttyslot, Previous: syncfs, Up: Glibc Extensions to <unistd.h> [Contents][Index]
syscallGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: vhangup, Previous: syscall, Up: Glibc Extensions to <unistd.h> [Contents][Index]
ttyslotGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: ttyslot, Up: Glibc Extensions to <unistd.h> [Contents][Index]
vhangupGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: Glibc Extensions to <utmpx.h>, Previous: Glibc Extensions to <unistd.h>, Up: Glibc Function Substitutes [Contents][Index]
<utmp.h>endutentgetutentgetutent_rgetutidgetutid_rgetutlinegetutline_rpututlinesetutentupdwtmputmpnameloginlogin_tty
Next: getutent, Up: Glibc <utmp.h> [Contents][Index]
endutentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutent_r, Previous: endutent, Up: Glibc <utmp.h> [Contents][Index]
getutentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutid, Previous: getutent, Up: Glibc <utmp.h> [Contents][Index]
getutent_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutid_r, Previous: getutent_r, Up: Glibc <utmp.h> [Contents][Index]
getutidGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutline, Previous: getutid, Up: Glibc <utmp.h> [Contents][Index]
getutid_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: getutline_r, Previous: getutid_r, Up: Glibc <utmp.h> [Contents][Index]
getutlineGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: pututline, Previous: getutline, Up: Glibc <utmp.h> [Contents][Index]
getutline_rGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: setutent, Previous: getutline_r, Up: Glibc <utmp.h> [Contents][Index]
pututlineGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: updwtmp, Previous: pututline, Up: Glibc <utmp.h> [Contents][Index]
setutentGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: utmpname, Previous: setutent, Up: Glibc <utmp.h> [Contents][Index]
updwtmpGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: login, Previous: updwtmp, Up: Glibc <utmp.h> [Contents][Index]
utmpnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: login_tty, Previous: utmpname, Up: Glibc <utmp.h> [Contents][Index]
loginGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: login, Up: Glibc <utmp.h> [Contents][Index]
login_ttyGnulib module: login_tty
Portability problems fixed by Gnulib:
-lutil on some platforms:
glibc 2.3.6, FreeBSD 6.0, NetBSD 5.0, OpenBSD 3.8.
It is available without link options on other platforms:
Mac OS X 10.5, OSF/1 5.1, Cygwin, Interix 3.5.
Portability problems not fixed by Gnulib:
<utmp.h> on glibc, Cygwin,
in <util.h> on Mac OS X 10.5, NetBSD 5.0, OpenBSD 3.8,
in <libutil.h> on FreeBSD 6.0, Haiku, and not declared at all
on OSF/1 5.1, Interix 3.5. Also note that <sys/types.h> is
a prerequisite of <utmp.h> on FreeBSD 8.0, OpenBSD 4.6 and
of <libutil.h> on FreeBSD 8.0.
Next: Glibc Extensions to <wchar.h>, Previous: Glibc <utmp.h>, Up: Glibc Function Substitutes [Contents][Index]
<utmpx.h>
Next: getutmpx, Up: Glibc Extensions to <utmpx.h> [Contents][Index]
getutmpGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: updwtmpx, Previous: getutmp, Up: Glibc Extensions to <utmpx.h> [Contents][Index]
getutmpxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Next: utmpxname, Previous: getutmpx, Up: Glibc Extensions to <utmpx.h> [Contents][Index]
updwtmpxGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: updwtmpx, Up: Glibc Extensions to <utmpx.h> [Contents][Index]
utmpxnameGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
Previous: Glibc Extensions to <utmpx.h>, Up: Glibc Function Substitutes [Contents][Index]
<wchar.h>fgetwc_unlockedfgetws_unlockedfputwc_unlockedfputws_unlockedgetwc_unlockedgetwchar_unlockedputwc_unlockedputwchar_unlockedwcschrnulwcsftime_lwcstod_lwcstof_lwcstol_lwcstold_lwcstoll_lwcstoqwcstoul_lwcstoull_lwcstouqwmempcpy
Next: fgetws_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
fgetwc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: fputwc_unlocked, Previous: fgetwc_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
fgetws_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: fputws_unlocked, Previous: fgetws_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
fputwc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: getwc_unlocked, Previous: fputwc_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
fputws_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: getwchar_unlocked, Previous: fputws_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
getwc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: putwc_unlocked, Previous: getwc_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
getwchar_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: putwchar_unlocked, Previous: getwchar_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
putwc_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcschrnul, Previous: putwc_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
putwchar_unlockedGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcsftime_l, Previous: putwchar_unlocked, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcschrnulGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstod_l, Previous: wcschrnul, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcsftime_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstof_l, Previous: wcsftime_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstod_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstol_l, Previous: wcstod_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstof_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstold_l, Previous: wcstof_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstol_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoll_l, Previous: wcstol_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstold_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoq, Previous: wcstold_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstoll_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoul_l, Previous: wcstoll_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstoqGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstoull_l, Previous: wcstoq, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstoul_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wcstouq, Previous: wcstoul_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstoull_lGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: wmempcpy, Previous: wcstoull_l, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wcstouqGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Previous: wcstouq, Up: Glibc Extensions to <wchar.h> [Contents][Index]
wmempcpyGnulib module: —
Portability problems fixed by Gnulib:
Portability problems not fixed by Gnulib:
wchar_t is a 16-bit type and therefore cannot
accommodate all Unicode characters.
Next: Particular Modules, Previous: Glibc Function Substitutes, Up: GNU Gnulib [Contents][Index]
There are three ways to create binaries that run on Microsoft Windows:
This chapter deals with the MinGW and MSVC platforms, commonly called “native Windows” platforms. Cygwin, on the other hand, is close enough to POSIX that it can be treated like any other Unix-like platform.
Next: Large File Support, Up: Native Windows Support [Contents][Index]
If you want it to be possible to compile your program for a native Windows
platform and you use Libtool, you need to use the win32-dll option of
LT_INIT. In other words, put:
LT_INIT([win32-dll])
in your configure.ac. This sets the correct names for the
OBJDUMP, DLLTOOL, and AS tools for the build.
If you are building a library, you will also need to pass
-no-undefined to make sure Libtool produces a DLL for your
library. From a Makefile.am:
libgsasl_la_LDFLAGS += -no-undefined
Next: Inode numbers on Windows, Previous: Libtool and Windows, Up: Native Windows Support [Contents][Index]
The module provides support for files larger than 2 GB.
To this effect, it ensures that off_t is a 64-bit integer type
at least on the following platforms:
glibc, Mac OS X, FreeBSD, NetBSD, OpenBSD, AIX, HP-UX, IRIX, OSF/1, Solaris,
Cygwin, mingw, MSVC.
Next: Precise file timestamps on Windows, Previous: Large File Support, Up: Native Windows Support [Contents][Index]
The module ‘windows-stat-inodes’ ensures that,
on native Windows platforms, struct stat contains
st_dev, st_ino fields that are able to distinguish
different inodes.
Note: Such values can only be provided for most files on the
file system. For a few files (such as inaccessible files),
st_dev and st_ino are set to 0. Therefore,
you should test whether st_dev != 0 && st_ino != 0,
before going to make inferences based on the file identity
based on st_dev and st_ino.
Next: Avoiding the year 2038 problem, Previous: Inode numbers on Windows, Up: Native Windows Support [Contents][Index]
The module ‘windows-stat-timespec’ ensures that,
on native Windows platforms, struct stat contains
st_atim, st_mtim, st_ctim fields of type
struct timespec, providing 100 ns resolution for the timestamps
of files.
Note: On some types of file systems, the timestamp resolution is limited
by the file system. For example, on FAT file systems, st_mtim
only has a resolution of 2 seconds. For more details, see
https://msdn.microsoft.com/en-us/library/ms724290.aspx.
Next: Windows sockets, Previous: Precise file timestamps on Windows, Up: Native Windows Support [Contents][Index]
The “year 2038 problem” denotes unpredictable behaviour of programs that will likely occur in the year 2038, for programs that use a 32-bit ‘time_t’ type. See https://en.wikipedia.org/wiki/Year_2038_problem for details.
The gnulib module ‘year2038’ attempts to avoid this problem, by
ensuring that time_t is a 64-bit type.
Next: Native Windows Support without MSVC Support, Previous: Avoiding the year 2038 problem, Up: Native Windows Support [Contents][Index]
One of the portability problems for native Windows are sockets and networking functions.
This was written for the getaddrinfo module, but may be applicable to
other functions too.
The getaddrinfo function exists in ws2tcpip.h and -lws2_32
on Windows XP. The function declaration is present if WINVER >= 0x0501.
Windows 2000 does not have getaddrinfo in its WS2_32.DLL.
Thus, if you want to assume Windows XP or later, you can add
AC_DEFINE([WINVER], [0x0501]) to avoid compiling the (partial)
getaddrinfo implementation.
If you want to support Windows 2000, don’t do anything. The
replacement function will open WS2_32.DLL during run-time to
see if there is a getaddrinfo function available, and use it when
available.
Previous: Windows sockets, Up: Native Windows Support [Contents][Index]
If your package does not desire to have MSVC support, that is, if MinGW
shall be the only native Windows platform that you wish to get support
for from Gnulib, and you wish to minimize the number of files imported
from Gnulib accordingly, you can do so by passing the options
‘--avoid=msvc-inval --avoid=msvc-nothrow’ to gnulib-tool.
Next: Regular expressions, Previous: Native Windows Support, Up: GNU Gnulib [Contents][Index]
Next: alloca-opt, Up: Particular Modules [Contents][Index]
The alloca module provides for a function alloca which allocates
memory on the stack, where the system allows it. A memory block allocated with
alloca exists only until the function that calls alloca returns
or exits abruptly.
There are a few systems where this is not possible: HP-UX systems, and some
other platforms when the C++ compiler is used. On these platforms the alloca
module provides a malloc based emulation. This emulation will not free a
memory block immediately when the calling function returns, but rather will
wait until the next alloca call from a function with the same or a
shorter stack length. Thus, in some cases, a few memory blocks will be kept
although they are not needed any more.
The user can #include <alloca.h> and use alloca on all platforms.
Note that the #include <alloca.h> must be the first one after the
autoconf-generated config.h, for AIX 3 compatibility. Thanks to IBM for
this nice restriction!
Note that GCC 3.1 and 3.2 can inline functions that call alloca.
When this happens, the memory blocks allocated with alloca will not be
freed until the end of the calling function. If this calling function
runs a loop calling the function that uses alloca, the program easily
gets a stack overflow and crashes. To protect against this compiler behaviour,
you can mark the function that uses alloca with the following attribute:
#ifdef __GNUC__ __attribute__ ((__noinline__)) #endif
An alternative to this module is the ‘alloca-opt’ module.
Next: Safe Allocation Macros, Previous: alloca, Up: Particular Modules [Contents][Index]
The alloca-opt module provides for a function alloca which allocates
memory on the stack, where the system allows it. A memory block allocated with
alloca exists only until the function that calls alloca returns
or exits abruptly.
There are a few systems where this is not possible: HP-UX systems, and some other platforms when the C++ compiler is used. On these platforms the alloca-opt module provides no replacement, just a preprocessor macro HAVE_ALLOCA.
The user can #include <alloca.h> on all platforms, and use
alloca on those platforms where the preprocessor macro HAVE_ALLOCA
evaluates to true. If HAVE_ALLOCA is false, the code should use a heap-based
memory allocation based on malloc or (in C++) new. Note that
the #include <alloca.h> must be the first one after the
autoconf-generated config.h, for AIX 3 compatibility. Thanks to IBM for
this nice restriction!
Note that GCC 3.1 and 3.2 can inline functions that call alloca.
When this happens, the memory blocks allocated with alloca will not be
freed until the end of the calling function. If this calling function
runs a loop calling the function that uses alloca, the program easily
gets a stack overflow and crashes. To protect against this compiler behaviour,
you can mark the function that uses alloca with the following attribute:
#ifdef __GNUC__ __attribute__ ((__noinline__)) #endif
Next: Compile-time Assertions, Previous: alloca-opt, Up: Particular Modules [Contents][Index]
The standard C library malloc/realloc/calloc/free APIs are prone to a
number of common coding errors. The safe-alloc module provides
macros that make it easier to avoid many of them. It still uses the
standard C allocation functions behind the scenes.
Some of the memory allocation mistakes that are commonly made are
malloc, especially
when allocating an array,
malloc and realloc for
errors,
malloc,
free by forgetting to set the pointer
variable to NULL,
realloc when that call fails.
The safe-alloc module addresses these problems in the following way:
__warn_unused_result__ attribute.
calloc instead of malloc.
Allocate sizeof(*ptr) bytes of memory and store the address of
allocated memory in ptr. Fill the newly allocated memory with
zeros.
Returns -1 on failure, 0 on success.
Allocate an array of count elements, each sizeof(*ptr)
bytes long, and store the address of allocated memory in
ptr. Fill the newly allocated memory with zeros.
Returns -1 on failure, 0 on success.
Allocate an array of count elements, each sizeof(*ptr)
bytes long, and store the address of allocated memory in
ptr. The allocated memory is not initialized.
Returns -1 on failure, 0 on success.
Reallocate the memory pointed to by ptr to be big enough to hold
at least count elements, each sizeof(*ptr) bytes long,
and store the address of allocated memory in ptr. If
reallocation fails, the ptr variable is not modified.
Returns -1 on failure, 0 on success.
Free the memory stored in ptr and set ptr to
NULL.
Next: Integer Properties, Previous: Safe Allocation Macros, Up: Particular Modules [Contents][Index]
This module provides a header file verify.h that defines macros related to compile-time verification.
Two of these macros are verify (V) and verify_expr
(V, EXPR). Both accept an integer constant expression
argument V and verify that it is nonzero. If not, a compile-time error
results.
These two macros implement compile-time tests, as opposed to
the standard assert macro which supports only runtime tests.
Since the tests occur at compile-time, they are more reliable, and
they require no runtime overhead.
verify (V); is a declaration; it can occur outside of
functions. In contrast, verify_expr (V, EXPR) is
an expression that returns the value of EXPR; it can be used in
macros that expand to expressions. If EXPR is an integer
constant expression, then verify_expr (V, EXPR) is
also an integer constant expression. Although EXPR and
verify_expr (V, EXPR) are guaranteed to have the
same side effects and value and type (after integer promotion), they
need not have the same type if EXPR’s type is an integer that is
narrower than int or unsigned int.
V should be an integer constant expression in the sense
of the C standard. Its leaf operands should be integer, enumeration,
or character constants; or sizeof expressions that return
constants; or floating constants that are the immediate operands of
casts. Outside a sizeof subexpression, V should
not contain any assignments, function calls, comma operators, casts to
non-integer types, or subexpressions whose values are outside the
representable ranges for their types. If V is not an
integer constant expression, then a compiler might reject a usage like
‘verify (V);’ even when V is
nonzero.
Although the standard assert macro is a runtime test, C11
specifies a builtin _Static_assert (V,
STRING-LITERAL), its assert.h header has a similar macro
named static_assert, and C++11 has a similar
static_assert builtin. These builtins and macros differ
from verify in two major ways. First, they can also be used
within a struct or union specifier, in place of an
ordinary member declaration. Second, they require the programmer to
specify a compile-time diagnostic as a string literal.
The verify.h header defines one more macro, assume
(E), which expands to an expression of type void
that causes the compiler to assume that E yields a nonzero
value. E should be a scalar expression, and should not
have side effects; it may or may not be evaluated. The behavior is
undefined if E would yield zero. The main use of assume
is optimization, as the compiler may be able to generate better code
if it assumes E. For best results, E should be simple
enough that a compiler can determine that it has no side effects: if
E calls an external function or accesses volatile storage the
compiler may not be able to optimize E away and assume
(E) may therefore slow down the program.
Here are some example uses of these macros.
#include <verify.h>
#include <limits.h>
#include <time.h>
/* Verify that time_t is an integer type. */
verify ((time_t) 1.5 == 1);
/* Verify that time_t is no smaller than int. */
verify (sizeof (int) <= sizeof (time_t));
/* Verify that time_t is signed. */
verify ((time_t) -1 < 0);
/* Verify that time_t uses two's complement representation. */
verify (~ (time_t) -1 == 0);
/* Return the maximum value of the integer type T,
verifying that T is an unsigned integer type.
The cast to (T) is outside the call to verify_expr
so that the result is of type T
even when T is narrower than unsigned int. */
#define MAX_UNSIGNED_VAL(t) \
((T) verify_expr (0 < (T) -1, -1))
/* Return T divided by CHAR_MAX + 1, where behavior is
undefined if T < 0. In the common case where CHAR_MAX
is 127 the compiler can therefore implement the division
by shifting T right 7 bits, an optimization that would
not be valid if T were negative. */
time_t
time_index (time_t t)
{
assume (0 <= t);
return t / (CHAR_MAX + 1);
}
Next: Extern inline functions, Previous: Compile-time Assertions, Up: Particular Modules [Contents][Index]
The intprops module consists of an include file <intprops.h>
that defines several macros useful for testing properties of integer
types.
Integer overflow is a common source of problems in programs written in C and other languages. In some cases, such as signed integer arithmetic in C programs, the resulting behavior is undefined, and practical platforms do not always behave as if integers wrap around reliably. In other cases, such as unsigned integer arithmetic in C, the resulting behavior is well-defined, but programs may still misbehave badly after overflow occurs.
Many techniques have been proposed to attack these problems. These include precondition testing, wraparound behavior where signed integer arithmetic is guaranteed to be modular, saturation semantics where overflow reliably yields an extreme value, undefined behavior sanitizers where overflow is guaranteed to trap, and various static analysis techniques.
Gnulib supports wraparound arithmetic and precondition testing, as these are relatively easy to support portably and efficiently. There are two families of precondition tests: the first, for integer types, is easier to use, while the second, for integer ranges, has a simple and straightforward portable implementation.
Next: Integer Bounds, Up: Integer Properties [Contents][Index]
TYPE_IS_INTEGER (t) is an arithmetic constant
expression that is 1 if the arithmetic type t is an integer type.
_Bool counts as an integer type.
TYPE_SIGNED (t) is an arithmetic constant expression
that is 1 if the real type t is a signed integer type or a
floating type. If t is an integer type, TYPE_SIGNED (t)
is an integer constant expression.
EXPR_SIGNED (e) is 1 if the real expression e
has a signed integer type or a floating type. If e is an
integer constant expression or an arithmetic constant expression,
EXPR_SIGNED (e) is likewise. Although e is
evaluated, if e is free of side effects then EXPR_SIGNED
(e) is typically optimized to a constant.
Example usage:
#include <intprops.h>
#include <time.h>
enum
{
time_t_is_signed_integer =
TYPE_IS_INTEGER (time_t) && TYPE_SIGNED (time_t)
};
int
CLOCKS_PER_SEC_is_signed (void)
{
return EXPR_SIGNED (CLOCKS_PER_SEC);
}
Next: Wraparound Arithmetic with Signed Integers, Previous: Arithmetic Type Properties, Up: Integer Properties [Contents][Index]
INT_BUFSIZE_BOUND (t) is an integer constant
expression that is a bound on the size of the string representing an
integer type or expression t in decimal notation, including the
terminating null character and any leading - character. For
example, if INT_STRLEN_BOUND (int) is 12, any value of type
int can be represented in 12 bytes or less, including the
terminating null. The bound is not necessarily tight.
Example usage:
#include <intprops.h>
#include <stdio.h>
int
int_strlen (int i)
{
char buf[INT_BUFSIZE_BOUND (int)];
return sprintf (buf, "%d", i);
}
INT_STRLEN_BOUND (t) is an integer constant
expression that is a bound on the length of the string representing an
integer type or expression t in decimal notation, including any
leading - character. This is one less than
INT_BUFSIZE_BOUND (t).
TYPE_MINIMUM (t) and TYPE_MAXIMUM (t) are
integer constant expressions equal to the minimum and maximum
values of the integer type t. These expressions are of the type
t (or more precisely, the type t after integer
promotions).
Example usage:
#include <stdint.h>
#include <sys/types.h>
#include <intprops.h>
int
in_off_t_range (intmax_t a)
{
return TYPE_MINIMUM (off_t) <= a && a <= TYPE_MAXIMUM (off_t);
}
Next: Integer Type Overflow, Previous: Integer Bounds, Up: Integer Properties [Contents][Index]
Signed integer arithmetic has undefined behavior on overflow in C.
Although almost all modern computers use two’s complement signed
arithmetic that is well-defined to wrap around, C compilers routinely
optimize assuming that signed integer overflow cannot occur, which
means that a C program cannot easily get at the underlying machine
arithmetic. For example, on a typical machine with 32-bit two’s
complement int the expression INT_MAX + 1 does not
necessarily yield INT_MIN, because the compiler may do
calculations with a 64-bit register, or may generate code that
traps on signed integer overflow.
The following macros work around this problem by storing the
wraparound value, i.e., the low-order bits of the correct answer, and
by returning an overflow indication. For example, if i is of
type int, INT_ADD_WRAPV (INT_MAX, 1, &i) sets i
to INT_MIN and returns 1 on a two’s complement machine. On
newer platforms, these macros are typically more efficient than the
overflow-checking macros. See Integer Type Overflow.
Example usage:
#include <intprops.h>
#include <stdio.h>
/* Print the low order bits of A * B,
reporting whether overflow occurred. */
void
print_product (long int a, long int b)
{
long int r;
int overflow = INT_MULTIPLY_WRAPV (a, b, &r);
printf ("result is %ld (%s)\n", r,
(overflow
? "after overflow"
: "no overflow"));
}
These macros have the following restrictions:
INT_ADD_WRAPV (a, b, r) ¶Store the low-order bits of the sum of a and b into
*r. Return true if overflow occurred, false if the
low-order bits are the mathematically-correct sum. See above for
restrictions.
INT_SUBTRACT_WRAPV (a, b, r) ¶Store the low-order bits of the difference between a and b
into *r. Return true if overflow occurred, false if the
low-order bits are the mathematically-correct difference. See above
for restrictions.
INT_MULTIPLY_WRAPV (a, b, r) ¶Store the low-order bits of the product of a and b into
*r. Return true if overflow occurred, false if the
low-order bits are the mathematically-correct product. See above for
restrictions.
Next: Integer Range Overflow, Previous: Wraparound Arithmetic with Signed Integers, Up: Integer Properties [Contents][Index]
Although unsigned integer arithmetic wraps around modulo a power of
two, signed integer arithmetic has undefined behavior on overflow in
C. Almost all modern computers use two’s complement signed
arithmetic that is well-defined to wrap around, but C compilers
routinely optimize based on the assumption that signed integer
overflow cannot occur, which means that a C program cannot easily get
at the underlying machine behavior. For example, the signed integer
expression (a + b < b) != (a < 0) is not a reliable test for
whether a + b overflows, because a compiler can assume that
signed overflow cannot occur and treat the entire expression as if it
were false.
These macros yield 1 if the corresponding C operators might not yield numerically correct answers due to arithmetic overflow of an integer type. They work correctly on all known practical hosts, and do not rely on undefined behavior due to signed arithmetic overflow. They are integer constant expressions if their arguments are. They are typically easier to use than the integer range overflow macros (see Integer Range Overflow), and they support more operations and evaluation contexts than the wraparound macros (see Wraparound Arithmetic with Signed Integers).
Example usage:
#include <intprops.h>
#include <limits.h>
#include <stdio.h>
/* Print A * B if in range, an overflow
indicator otherwise. */
void
print_product (long int a, long int b)
{
if (INT_MULTIPLY_OVERFLOW (a, b))
printf ("multiply would overflow");
else
printf ("product is %ld", a * b);
}
/* Does the product of two ints always fit
in a long int? */
enum {
INT_PRODUCTS_FIT_IN_LONG
= ! (INT_MULTIPLY_OVERFLOW
((long int) INT_MIN, INT_MIN))
};
These macros have the following restrictions:
These macros are tuned for their last argument being a constant.
INT_ADD_OVERFLOW (a, b) ¶Yield 1 if a + b would overflow. See above for
restrictions.
INT_SUBTRACT_OVERFLOW (a, b) ¶Yield 1 if a - b would overflow. See above for
restrictions.
INT_NEGATE_OVERFLOW (a) ¶Yields 1 if -a would overflow. See above for restrictions.
INT_MULTIPLY_OVERFLOW (a, b) ¶Yield 1 if a * b would overflow. See above for
restrictions.
INT_DIVIDE_OVERFLOW (a, b) ¶Yields 1 if a / b would overflow. See above for
restrictions. Division overflow can happen on two’s complement hosts
when dividing the most negative integer by -1. This macro does
not check for division by zero.
INT_REMAINDER_OVERFLOW (a, b) ¶Yield 1 if a % b would overflow. See above for
restrictions. Remainder overflow can happen on two’s complement hosts
when dividing the most negative integer by -1; although the
mathematical result is always 0, in practice some implementations
trap, so this counts as an overflow. This macro does not check for
division by zero.
INT_LEFT_SHIFT_OVERFLOW (a, b) ¶Yield 1 if a << b would overflow. See above for
restrictions. The C standard says that behavior is undefined for
shifts unless 0≤b<w where w is a’s word
width, and that when a is negative then a <<
b has undefined behavior, but this macro does not check these
other restrictions.
Previous: Integer Type Overflow, Up: Integer Properties [Contents][Index]
These macros yield 1 if the corresponding C operators might not yield numerically correct answers due to arithmetic overflow. They do not rely on undefined or implementation-defined behavior. They are integer constant expressions if their arguments are. Their implementations are simple and straightforward, but they are typically harder to use than the integer type overflow macros. See Integer Type Overflow.
Although the implementation of these macros is similar to that suggested in Seacord R, The CERT C Secure Coding Standard (2009, revised 2011), in its two sections “INT30-C. Ensure that unsigned integer operations do not wrap” and “INT32-C. Ensure that operations on signed integers do not result in overflow”, Gnulib’s implementation was derived independently of CERT’s suggestions.
Example usage:
#include <intprops.h>
#include <limits.h>
#include <stdio.h>
void
print_product (long int a, long int b)
{
if (INT_MULTIPLY_RANGE_OVERFLOW (a, b, LONG_MIN, LONG_MAX))
printf ("multiply would overflow");
else
printf ("product is %ld", a * b);
}
/* Does the product of two ints always fit
in a long int? */
enum {
INT_PRODUCTS_FIT_IN_LONG
= ! (INT_MULTIPLY_RANGE_OVERFLOW
((long int) INT_MIN, (long int) INT_MIN,
LONG_MIN, LONG_MAX))
};
These macros have the following restrictions:
(unsigned int) 0.
These macros are tuned for constant min and max. For
commutative operations such as a + b, they are also
tuned for constant b.
INT_ADD_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a + b would overflow in
[min,max] integer arithmetic. See above for restrictions.
INT_SUBTRACT_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a - b would overflow in
[min,max] integer arithmetic. See above for restrictions.
INT_NEGATE_RANGE_OVERFLOW (a, min, max) ¶Yield 1 if -a would overflow in [min,max]
integer arithmetic. See above for restrictions.
INT_MULTIPLY_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a * b would overflow in
[min,max] integer arithmetic. See above for restrictions.
INT_DIVIDE_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a / b would overflow in
[min,max] integer arithmetic. See above for restrictions.
Division overflow can happen on two’s complement hosts when dividing
the most negative integer by -1. This macro does not check for
division by zero.
INT_REMAINDER_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a % b would overflow in
[min,max] integer arithmetic. See above for restrictions.
Remainder overflow can happen on two’s complement hosts when dividing
the most negative integer by -1; although the mathematical
result is always 0, in practice some implementations trap, so this
counts as an overflow. This macro does not check for division by
zero.
INT_LEFT_SHIFT_RANGE_OVERFLOW (a, b, min, max) ¶Yield 1 if a << b would overflow in
[min,max] integer arithmetic. See above for restrictions.
Here, min and max are for a only, and b need
not be of the same type as the other arguments. The C standard says
that behavior is undefined for shifts unless 0≤b<w
where w is a’s word width, and that when a is negative
then a << b has undefined behavior, but this macro
does not check these other restrictions.
Next: Character and String Functions in C Locale, Previous: Integer Properties, Up: Particular Modules [Contents][Index]
The extern-inline module supports the use of C99-style
extern inline functions so that the code still runs on
compilers that do not support this feature correctly.
C code ordinarily should not use inline. Typically it is
better to let the compiler figure out whether to inline, as compilers
are pretty good about optimization nowadays. In this sense,
inline is like register, another keyword that is
typically no longer needed.
Functions defined (not merely declared) in headers are an exception,
as avoiding inline would commonly cause problems for these
functions. Suppose aaa.h defines the function aaa_fun,
and aaa.c, bbb.c and ccc.c all include
aaa.h. If code is intended to portable to non-C99 compilers,
aaa_fun cannot be declared with the C99 inline keyword.
This problem cannot be worked around by making aaa_fun an
ordinary function, as it would be defined three times with external
linkage and the definitions would clash. Although aaa_fun
could be a static function, with separate compilation if
aaa_fun is not inlined its code will appear in the executable
three times.
To avoid this code bloat, aaa.h can do this:
/* aaa.h */
/* #include any other headers here */
#ifndef _GL_INLINE_HEADER_BEGIN
#error "Please include config.h first."
#endif
_GL_INLINE_HEADER_BEGIN
#ifndef AAA_INLINE
# define AAA_INLINE _GL_INLINE
#endif
...
AAA_INLINE int
aaa_fun (int i)
{
return i + 1;
}
...
_GL_INLINE_HEADER_END
and aaa.c can do this:
/* aaa.c */ #include <config.h> #define AAA_INLINE _GL_EXTERN_INLINE #include <aaa.h>
whereas bbb.c and ccc.c can include aaa.h in the
usual way. C99 compilers expand AAA_INLINE to C99-style
inline usage, where aaa_fun is declared extern
inline in aaa.c and plain inline in other modules.
Non-C99 compilers that are compatible with GCC use GCC-specific syntax
to accomplish the same ends. Other non-C99 compilers use static
inline so they suffer from code bloat, but they are not mainline
platforms and will die out eventually.
_GL_INLINE is a portable alternative to C99 plain inline.
_GL_EXTERN_INLINE is a portable alternative to C99 extern inline.
Invoke _GL_INLINE_HEADER_BEGIN before all uses of
_GL_INLINE in an include file. This suppresses some
bogus warnings in GCC versions before 5.1. If an include file includes
other files, it is better to invoke this macro after including the
other files.
Invoke _GL_INLINE_HEADER_END after all uses of
_GL_INLINE in an include file.
Next: Quoting, Previous: Extern inline functions, Up: Particular Modules [Contents][Index]
The functions in this section are similar to the generic string functions from the standard C library, except that
Next: c-strcase, Up: Character and String Functions in C Locale [Contents][Index]
The c-ctype module contains functions operating on single-byte
characters, like the functions in <ctype.h>, that operate as if the
locale encoding was ASCII. (The "C" locale on many systems has the locale
encoding "ASCII".)
The functions are:
extern bool c_isascii (int c); extern bool c_isalnum (int c); extern bool c_isalpha (int c); extern bool c_isblank (int c); extern bool c_iscntrl (int c); extern bool c_isdigit (int c); extern bool c_islower (int c); extern bool c_isgraph (int c); extern bool c_isprint (int c); extern bool c_ispunct (int c); extern bool c_isspace (int c); extern bool c_isupper (int c); extern bool c_isxdigit (int c); extern int c_tolower (int c); extern int c_toupper (int c);
These functions assign properties only to ASCII characters.
The c argument can be a char or unsigned char value,
whereas the corresponding functions in <ctype.h> take an argument
that is actually an unsigned char value.
The c_is* functions return ‘bool’, where the corresponding
functions in <ctype.h> return ‘int’ for historical reasons.
Note: The <ctype.h> functions support only unibyte locales.
Next: c-strcaseeq, Previous: c-ctype, Up: Character and String Functions in C Locale [Contents][Index]
The c-strcase module contains case-insensitive string comparison
functions operating on single-byte character strings, like the functions in
<strings.h>, that operate as if the locale encoding was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The functions are:
extern int c_strcasecmp (const char *s1, const char *s2); extern int c_strncasecmp (const char *s1, const char *s2, size_t n);
For case conversion here, only ASCII characters are considered to be upper case or lower case.
Note: The functions strcasecmp, strncasecmp from
<strings.h> support only unibyte locales; for multibyte locales,
you need the functions mbscasecmp, mbsncasecmp,
mbspcasecmp.
Next: c-strcasestr, Previous: c-strcase, Up: Character and String Functions in C Locale [Contents][Index]
The c-strcaseeq module contains an optimized case-insensitive
string comparison function operating on single-byte character strings, that
operate as if the locale encoding was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The functions is actually implemented as a macro:
extern int STRCASEEQ (const char *s1, const char *s2,
int s20, int s21, int s22, int s23, int s24, int s25,
int s26, int s27, int s28);
s2 should be a short literal ASCII string, and s20, s21, ... the individual characters of s2.
For case conversion here, only ASCII characters are considered to be upper case or lower case.
Next: c-strstr, Previous: c-strcaseeq, Up: Character and String Functions in C Locale [Contents][Index]
The c-strcasestr module contains a case-insensitive string search
function operating on single-byte character strings, that operate as if the
locale encoding was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The function is:
extern char *c_strcasestr (const char *haystack, const char *needle);
For case conversion here, only ASCII characters are considered to be upper case or lower case.
Note: The function strcasestr from <string.h> supports only
unibyte locales; for multibyte locales, you need the function
mbscasestr.
Next: c-strtod, Previous: c-strcasestr, Up: Character and String Functions in C Locale [Contents][Index]
The c-strstr module contains a substring search function operating
on single-byte character strings, that operate as if the locale encoding
was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The function is:
extern char *c_strstr (const char *haystack, const char *needle);
Note: The function strstr from <string.h> supports only
unibyte locales; for multibyte locales, you need the function
mbsstr.
Next: c-strtold, Previous: c-strstr, Up: Character and String Functions in C Locale [Contents][Index]
The c-strtod module contains a string to number (‘double’)
conversion function operating on single-byte character strings, that operates
as if the locale encoding was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The function is:
extern double c_strtod (const char *string, char **endp);
In particular, only a period ‘.’ is accepted as decimal point, even when the current locale’s notion of decimal point is a comma ‘,’, and no characters outside the basic character set are accepted.
On platforms without strtod_l, this function is not safe for use in
multi-threaded applications since it calls setlocale.
Previous: c-strtod, Up: Character and String Functions in C Locale [Contents][Index]
The c-strtold module contains a string to number (‘long double’)
conversion function operating on single-byte character strings, that operates
as if the locale encoding was ASCII.
(The "C" locale on many systems has the locale encoding "ASCII".)
The function is:
extern long double c_strtold (const char *string, char **endp);
In particular, only a period ‘.’ is accepted as decimal point, even when the current locale’s notion of decimal point is a comma ‘,’.
Next: error and progname, Previous: Character and String Functions in C Locale, Up: Particular Modules [Contents][Index]
Gnulib provides ‘quote’ and ‘quotearg’ modules to help with quoting text, such as file names, in messages to the user. Here’s an example of using ‘quote’:
#include <quote.h>
...
error (0, errno, _("cannot change owner of %s"), quote (fname));
This differs from
error (0, errno, _("cannot change owner of '%s'"), fname);
in that quote escapes unusual characters in
fname, e.g., ‘'’ and control characters like ‘\n’.
However, a caveat: quote reuses the storage that it returns.
Hence if you need more than one thing quoted at the same time, you
need to use quote_n.
Also, the quote module is not suited for multithreaded applications.
In that case, you have to use quotearg_alloc, defined in the
‘quotearg’ module, which is decidedly less convenient.
Next: gcd: greatest common divisor, Previous: Quoting, Up: Particular Modules [Contents][Index]
The error function uses the program_name variable, but
does not depend on the progname module. Why? Because
error is released under the LGPL, whereas progname is
GPL. RMS does not want additional baggage accompanying the
error module, so an LGPL user must provide their own
replacement program_name, and a GPL user should manually
specify using the progname module.
Additionally, using the progname module is not something that
can be done implicitly. It requires that every main function
be modified to set program_name as one of its first actions.
Next: Library version handling, Previous: error and progname, Up: Particular Modules [Contents][Index]
The gcd function returns the greatest common divisor of two numbers
a > 0 and b > 0. It is the caller’s responsibility to ensure
that the arguments are non-zero.
If you need a gcd function for an integer type larger than ‘unsigned long’, you can include the gcd.c implementation file with parametrization. The parameters are:
The created function has the prototype
WORD_T GCD (WORD_T a, WORD_T b);
If you need the least common multiple of two numbers, it can be computed
like this: lcm(a,b) = (a / gcd(a,b)) * b or
lcm(a,b) = a * (b / gcd(a,b)).
Avoid the formula lcm(a,b) = (a * b) / gcd(a,b) because—although
mathematically correct—it can yield a wrong result, due to integer overflow.
In some applications it is useful to have a function taking the gcd of two signed numbers. In this case, the gcd function result is usually normalized to be non-negative (so that two gcd results can be compared in magnitude or compared against 1, etc.). Note that in this case the prototype of the function has to be
unsigned long gcd (long a, long b);
and not
long gcd (long a, long b);
because gcd(LONG_MIN,LONG_MIN) = -LONG_MIN = LONG_MAX + 1 does not
fit into a signed ‘long’.
Next: Supporting Relocation, Previous: gcd: greatest common divisor, Up: Particular Modules [Contents][Index]
The module ‘check-version’ can be useful when your gnulib
application is a system library. You will typically wrap the call to
the check_version function through a library API, your library
header file may contain:
#define STRINGPREP_VERSION "0.5.18" ... extern const char *stringprep_check_version (const char *req_version);
To avoid ELF symbol collisions with other libraries that use the ‘check-version’ module, add to config.h through a AC_DEFINE something like:
AC_DEFINE(check_version, stringprep_check_version,
[Rename check_version.])
The stringprep_check_version function will thus be implemented
by the check_version module.
There are two uses of the interface. The first is a way to provide for applications to find out the version number of the library it uses. The application may contain diagnostic code such as:
printf ("Stringprep version: header %s library %s",
STRINGPREP_VERSION,
stringprep_check_version (NULL));
Separating the library and header file version can be useful when searching for version mismatch related problems.
The second uses is as a rudimentary test of proper library version, by making sure the application get a library version that is the same, or newer, than the header file used when building the application. This doesn’t catch all problems, libraries may change backwards incompatibly in later versions, but enable applications to require a certain minimum version before it may proceed.
Typical uses look like:
/* Check version of libgcrypt. */
if (!gcry_check_version (GCRYPT_VERSION))
die ("version mismatch\n");
Next: func, Previous: Library version handling, Up: Particular Modules [Contents][Index]
It has been a pain for many users of GNU packages for a long time that
packages are not relocatable. It means a user cannot copy a program,
installed by another user on the same machine, to his home directory,
and have it work correctly (including i18n). So many users need to go
through configure; make; make install with all its
dependencies, options, and hurdles.
Red Hat, Debian, and other binary distributions solve the “ease of installation” problem, but they hardwire path names, usually to /usr or /usr/local. This means that users need root privileges to install a binary package, and prevents installing two different versions of the same binary package.
A relocatable program can be moved or copied to a different location on the file system. It is possible to make symlinks to the installed and moved programs, and invoke them through the symlink. It is possible to do the same thing with a hard link only if the hard link file is in the same directory as the real program.
The relocatable-prog module aims to ease the process of making a
GNU program relocatable. It helps overcome two obstacles. First, it aids
with relocating the hard-coded references to absolute file names that
GNU programs often contain. These references must be fixed up at
runtime if a program is to be successfully relocated. The
relocatable-prog module provides a function relocate that
does this job.
Second, the loader must be able to find shared libraries linked to
relocatable executables or referenced by other shared libraries linked
to relocatable executables. The relocatable-prog module helps out
here in a platform-specific way:
LD_LIBRARY_PATH) and then invokes the real executable.
You can make your program relocatable by following these steps:
relocatable-prog module. For libraries, use the
relocatable-lib or relocatable-lib-lgpl module.
If you need more than one module, or you need to use them with different
settings, you will need multiple copies of gnulib (see Using Gnulib for both a library and a program).
main as the first statement (even
before setting the locale or doing anything related to libintl):
set_program_name (argv[0]);
The prototype for this function is in progname.h.
set_relocation_prefix.
relocate so it gets translated to the run-time situation.
Example:
bindtextdomain (PACKAGE, LOCALEDIR);
becomes:
bindtextdomain (PACKAGE, relocate (LOCALEDIR));
The prototype for this function is in relocatable.h.
There is also a variant of this function, named relocate2, that
makes it easy to reclaim the memory allocated by the call.
set_program_name function can also configure some
additional libraries to relocate files that they access, by defining
corresponding C preprocessor symbols to 1. The libraries for which
this is supported and the corresponding preprocessor symbols are:
DEPENDS_ON_LIBCHARSET
DEPENDS_ON_LIBICONV
DEPENDS_ON_LIBINTL
Defining the symbol for a library makes every program in the package depend on that library, whether the program really uses the library or not, so this feature should be used with some caution.
relocatable-script module. Then, near the beginning of each
shell script that your package installs, add the following:
@relocatable_sh@
if test "@RELOCATABLE@" = yes; then
exec_prefix="@exec_prefix@"
bindir="@bindir@"
orig_installdir="$bindir" # see Makefile.am's *_SCRIPTS variables
func_find_curr_installdir # determine curr_installdir
func_find_prefixes
relocate () {
echo "$1/" \
| sed -e "s%^${orig_installprefix}/%${curr_installprefix}/%" \
| sed -e 's,/$,,'
}
else
relocate () {
echo "$1"
}
fi
# Get some relocated directory names.
sysconfdir=`relocate "@sysconfdir@"`
some_datadir=`relocate "@datadir@/something"`
You must adapt the definition of orig_installdir, depending on
where the script gets installed. Also, at the end, instead of
sysconfdir and some_datadir, transform those variables
that you need.
relocatable-perl module. Then, near the beginning of each
Perl script that your package installs, add the following:
@relocatable_pl@
if ("@RELOCATABLE@" eq "yes") {
my $exec_prefix = "@exec_prefix@";
my $orig_installdir = "@bindir@"; # see Makefile.am's *_SCRIPTS variables
my ($orig_installprefix, $curr_installprefix) = find_prefixes($orig_installdir, find_curr_installdir());
sub relocate { # the subroutine is defined whether or not the enclosing block is executed
my ($dir) = @_;
if ("@RELOCATABLE@" eq "yes") {
$dir =~ s%^$orig_installprefix/%$curr_installprefix/%;
$dir =~ s,/$,,;
}
return $dir;
}
}
# Get some relocated directory names.
# (The gnulib module 'configmake' can help with this.)
$sysconfdir = relocate("@sysconfdir@");
$some_datadir = relocate(@datadir@/something");
You must adapt the definition of $orig_installdir, depending on
where the script gets installed. Also, at the end, instead of
sysconfdir and some_datadir, transform those variables
that you need.
foo that gets
installed in, say, $(bindir), you add:
foo_CPPFLAGS = -DINSTALLDIR=\"$(bindir)\" if RELOCATABLE_VIA_LD foo_LDFLAGS = `$(RELOCATABLE_LDFLAGS) $(bindir)` endif
When building gnulib to use with a relocatable library, you need to
define the preprocessor symbol IN_LIBRARY.
You may also want to build with ENABLE_COSTLY_RELOCATABLE, in which case
you will also need to define INSTALLDIR.
The following fragment can be added to an override Makefile.am used
to build gnulib (see Modifying the build rules of a Gnulib import directory).
AM_CPPFLAGS += -DIN_LIBRARY -DENABLE_COSTLY_RELOCATABLE if SHLIBS_IN_BINDIR AM_CPPFLAGS += -DINSTALLDIR=\"$(bindir)\" else AM_CPPFLAGS += -DINSTALLDIR=\"$(libdir)\" endif
SHLIBS_IN_BINDIR is defined in configure.ac as follows:
AM_CONDITIONAL([SHLIBS_IN_BINDIR], [case "$host_os" in mingw* | cygwin*) true;; *) false;; esac])
If your package (or any package you rely on, e.g. gettext-runtime) will be relocated together with a set of installed shared libraries, then set RELOCATABLE_LIBRARY_PATH to a colon-separated list of those libraries’ directories, e.g.
RELOCATABLE_LIBRARY_PATH='$(libdir)'
If your config.h is not in $(top_builddir), then set RELOCATABLE_CONFIG_H_DIR to its directory, e.g.
RELOCATABLE_CONFIG_H_DIR='$(top_builddir)/src'
Next: stat-size, Previous: Supporting Relocation, Up: Particular Modules [Contents][Index]
The func module makes sure that you can use the predefined
identifier __func__ as defined by C99 in your code.
A small example is:
#include <config.h>
#include <stdio.h> /* for printf */
int main (void)
{
printf ("%s: hello world\n", __func__);
}
Note that sizeof cannot be applied to __func__: On SunPRO C
compiler, sizeof __func__ evaluates to 0.
Previous: func, Up: Particular Modules [Contents][Index]
The stat-size module provides a small number of macros
intended for interpreting the file size information in an instance of
struct stat.
On POSIX systems, the st_blocks member of struct stat
contains the number of disk blocks occupied by a file. The
ST_NBLOCKS macro is used to estimate this quantity on systems
which don’t actually have st_blocks. Each of these blocks
contains ST_NBLOCKSIZE bytes.
The value of ST_NBLOCKSIZE is often quite small, small enough
that performing I/O in chunks that size would be inefficient.
ST_BLKSIZE is the I/O block size recommended for I/O to this
file. This is not guaranteed to give optimum performance, but it
should be reasonably efficient.
Next: Build Infrastructure Modules, Previous: Particular Modules, Up: GNU Gnulib [Contents][Index]
Next: Regular Expression Syntax, Up: Regular expressions [Contents][Index]
A regular expression (or regexp, or pattern) is a text string that describes some (mathematical) set of strings. A regexp r matches a string s if s is in the set of strings described by r.
Using the Regex library, you can:
Some regular expressions match only one string, i.e., the set they describe has only one member. For example, the regular expression ‘foo’ matches the string ‘foo’ and no others. Other regular expressions match more than one string, i.e., the set they describe has more than one member. For example, the regular expression ‘f*’ matches the set of strings made up of any number (including zero) of ‘f’s. As you can see, some characters in regular expressions match themselves (such as ‘f’) and some don’t (such as ‘*’); the ones that don’t match themselves instead let you specify patterns that describe many different strings.
To either match or search for a regular expression with the Regex library functions, you must first compile it with a Regex pattern compiling function. A compiled pattern is a regular expression converted to the internal format used by the library functions. Once you’ve compiled a pattern, you can use it for matching or searching any number of times.
The Regex library is used by including regex.h. Regex provides three groups of functions with which you can operate on regular expressions. One group—the GNU group—is more powerful but not completely compatible with the other two, namely the POSIX and Berkeley Unix groups; its interface was designed specifically for GNU.
We wrote this chapter with programmers in mind, not users of programs—such as Emacs—that use Regex. We describe the Regex library in its entirety, not how to write regular expressions that a particular program understands.
Next: Common Operators, Previous: Overview, Up: Regular expressions [Contents][Index]
Characters are things you can type. Operators are things in a regular expression that match one or more characters. You compose regular expressions from operators, which in turn you specify using one or more characters.
Most characters represent what we call the match-self operator, i.e., they match themselves; we call these characters ordinary. Other characters represent either all or parts of fancier operators; e.g., ‘.’ represents what we call the match-any-character operator (which, no surprise, matches (almost) any character); we call these characters special. Two different things determine what characters represent what operators:
In the following sections, we describe these things in more detail.
Next: Predefined Syntaxes, Up: Regular Expression Syntax [Contents][Index]
In any particular syntax for regular expressions, some characters are
always special, others are sometimes special, and others are never
special. The particular syntax that Regex recognizes for a given
regular expression depends on the current syntax (as set by
re_set_syntax) when the pattern buffer of that regular expression
was compiled.
You get a pattern buffer by compiling a regular expression. See GNU Pattern Buffers, for more information on pattern buffers. See GNU Regular Expression Compiling, and BSD Regular Expression Compiling, for more information on compiling.
Regex considers the current syntax to be a collection of bits; we refer to these bits as syntax bits. In most cases, they affect what characters represent what operators. We describe the meanings of the operators to which we refer in Common Operators, GNU Operators, and GNU Emacs Operators.
For reference, here is the complete list of syntax bits, in alphabetical order:
RE_BACKSLASH_ESCAPE_IN_LISTSIf this bit is set, then ‘\’ inside a list (see List Operators ([ … ] and [^ … ])
quotes (makes ordinary, if it’s special) the following character; if
this bit isn’t set, then ‘\’ is an ordinary character inside lists.
(See The Backslash Character, for what ‘\’ does outside of lists.)
RE_BK_PLUS_QMIf this bit is set, then ‘\+’ represents the match-one-or-more
operator and ‘\?’ represents the match-zero-or-more operator; if
this bit isn’t set, then ‘+’ represents the match-one-or-more
operator and ‘?’ represents the match-zero-or-one operator. This
bit is irrelevant if RE_LIMITED_OPS is set.
RE_CHAR_CLASSESIf this bit is set, then you can use character classes in lists; if this bit isn’t set, then you can’t.
RE_CONTEXT_INDEP_ANCHORSIf this bit is set, then ‘^’ and ‘$’ are special anywhere outside
a list; if this bit isn’t set, then these characters are special only in
certain contexts. See The Match-beginning-of-line Operator (^), and
The Match-end-of-line Operator ($).
RE_CONTEXT_INDEP_OPSIf this bit is set, then certain characters are special anywhere outside
a list; if this bit isn’t set, then those characters are special only in
some contexts and are ordinary elsewhere. Specifically, if this bit
isn’t set then ‘*’, and (if the syntax bit RE_LIMITED_OPS
isn’t set) ‘+’ and ‘?’ (or ‘\+’ and ‘\?’, depending
on the syntax bit RE_BK_PLUS_QM) represent repetition operators
only if they’re not first in a regular expression or just after an
open-group or alternation operator. The same holds for ‘{’ (or
‘\{’, depending on the syntax bit RE_NO_BK_BRACES) if
it is the beginning of a valid interval and the syntax bit
RE_INTERVALS is set.
RE_CONTEXT_INVALID_DUPIf this bit is set, then an open-interval operator cannot occur at the start of a regular expression, or immediately after an alternation, open-group or close-interval operator.
RE_CONTEXT_INVALID_OPSIf this bit is set, then repetition and alternation operators can’t be in certain positions within a regular expression. Specifically, the regular expression is invalid if it has:
If this bit isn’t set, then you can put the characters representing the repetition and alternation characters anywhere in a regular expression. Whether or not they will in fact be operators in certain positions depends on other syntax bits.
RE_DEBUGIf this bit is set, and the regex library was compiled with
-DDEBUG, then internal debugging is turned on; if unset, then
it is turned off.
RE_DOT_NEWLINEIf this bit is set, then the match-any-character operator matches a newline; if this bit isn’t set, then it doesn’t.
RE_DOT_NOT_NULLIf this bit is set, then the match-any-character operator doesn’t match a null character; if this bit isn’t set, then it does.
RE_HAT_LISTS_NOT_NEWLINEIf this bit is set, nonmatching lists ‘[^...]’ do not match newline; if not set, they do.
RE_ICASEIf this bit is set, then ignore case when matching; otherwise, case is significant.
RE_INTERVALSIf this bit is set, then Regex recognizes interval operators; if this bit isn’t set, then it doesn’t.
RE_INVALID_INTERVAL_ORDIf this bit is set, a syntactically invalid interval is treated as a string of ordinary characters. For example, the extended regular expression ‘a{1’ is treated as ‘a\{1’.
RE_LIMITED_OPSIf this bit is set, then Regex doesn’t recognize the match-one-or-more, match-zero-or-one or alternation operators; if this bit isn’t set, then it does.
RE_NEWLINE_ALTIf this bit is set, then newline represents the alternation operator; if this bit isn’t set, then newline is ordinary.
RE_NO_BK_BRACESIf this bit is set, then ‘{’ represents the open-interval operator
and ‘}’ represents the close-interval operator; if this bit isn’t
set, then ‘\{’ represents the open-interval operator and
‘\}’ represents the close-interval operator. This bit is relevant
only if RE_INTERVALS is set.
RE_NO_BK_PARENSIf this bit is set, then ‘(’ represents the open-group operator and ‘)’ represents the close-group operator; if this bit isn’t set, then ‘\(’ represents the open-group operator and ‘\)’ represents the close-group operator.
RE_NO_BK_REFSIf this bit is set, then Regex doesn’t recognize ‘\’digit as the back reference operator; if this bit isn’t set, then it does.
RE_NO_BK_VBARIf this bit is set, then ‘|’ represents the alternation operator;
if this bit isn’t set, then ‘\|’ represents the alternation
operator. This bit is irrelevant if RE_LIMITED_OPS is set.
RE_NO_EMPTY_RANGESIf this bit is set, then a regular expression with a range whose ending point collates lower than its starting point is invalid; if this bit isn’t set, then Regex considers such a range to be empty.
RE_NO_GNU_OPSIf this bit is set, GNU regex operators are not recognized; otherwise, they are.
RE_NO_POSIX_BACKTRACKINGIf this bit is set, succeed as soon as we match the whole pattern, without further backtracking. This means that a match may not be the leftmost longest; see What Gets Matched? for what this means.
RE_NO_SUBIf this bit is set, then no_sub will be set to one during
re_compile_pattern. This causes matching and searching routines
not to record substring match information.
RE_UNMATCHED_RIGHT_PAREN_ORDIf this bit is set and the regular expression has no matching open-group
operator, then Regex considers what would otherwise be a close-group
operator (based on how RE_NO_BK_PARENS is set) to match ‘)’.
Next: Collating Elements vs. Characters, Previous: Syntax Bits, Up: Regular Expression Syntax [Contents][Index]
If you’re programming with Regex, you can set a pattern buffer’s (see GNU Pattern Buffers) syntax either to an arbitrary combination of syntax bits (see Syntax Bits) or else to the configurations defined by Regex. These configurations define the syntaxes used by certain programs—GNU Emacs, POSIX Awk, traditional Awk, Grep, Egrep—in addition to syntaxes for POSIX basic and extended regular expressions.
The predefined syntaxes—taken directly from regex.h—are:
#define RE_SYNTAX_EMACS 0 #define RE_SYNTAX_AWK \ (RE_BACKSLASH_ESCAPE_IN_LISTS | RE_DOT_NOT_NULL \ | RE_NO_BK_PARENS | RE_NO_BK_REFS \ | RE_NO_BK_VBAR | RE_NO_EMPTY_RANGES \ | RE_UNMATCHED_RIGHT_PAREN_ORD) #define RE_SYNTAX_POSIX_AWK \ (RE_SYNTAX_POSIX_EXTENDED | RE_BACKSLASH_ESCAPE_IN_LISTS) #define RE_SYNTAX_GREP \ (RE_BK_PLUS_QM | RE_CHAR_CLASSES \ | RE_HAT_LISTS_NOT_NEWLINE | RE_INTERVALS \ | RE_NEWLINE_ALT) #define RE_SYNTAX_EGREP \ (RE_CHAR_CLASSES | RE_CONTEXT_INDEP_ANCHORS \ | RE_CONTEXT_INDEP_OPS | RE_HAT_LISTS_NOT_NEWLINE \ | RE_NEWLINE_ALT | RE_NO_BK_PARENS \ | RE_NO_BK_VBAR) #define RE_SYNTAX_POSIX_EGREP \ (RE_SYNTAX_EGREP | RE_INTERVALS | RE_NO_BK_BRACES) /* P1003.2/D11.2, section 4.20.7.1, lines 5078ff. */ #define RE_SYNTAX_ED RE_SYNTAX_POSIX_BASIC #define RE_SYNTAX_SED RE_SYNTAX_POSIX_BASIC /* Syntax bits common to both basic and extended POSIX regex syntax. */ #define _RE_SYNTAX_POSIX_COMMON \ (RE_CHAR_CLASSES | RE_DOT_NEWLINE | RE_DOT_NOT_NULL \ | RE_INTERVALS | RE_NO_EMPTY_RANGES) #define RE_SYNTAX_POSIX_BASIC \ (_RE_SYNTAX_POSIX_COMMON | RE_BK_PLUS_QM) /* Differs from ..._POSIX_BASIC only in that RE_BK_PLUS_QM becomes RE_LIMITED_OPS, i.e., \? \+ \| are not recognized. Actually, this isn't minimal, since other operators, such as \`, aren't disabled. */ #define RE_SYNTAX_POSIX_MINIMAL_BASIC \ (_RE_SYNTAX_POSIX_COMMON | RE_LIMITED_OPS) #define RE_SYNTAX_POSIX_EXTENDED \ (_RE_SYNTAX_POSIX_COMMON | RE_CONTEXT_INDEP_ANCHORS \ | RE_CONTEXT_INDEP_OPS | RE_NO_BK_BRACES \ | RE_NO_BK_PARENS | RE_NO_BK_VBAR \ | RE_UNMATCHED_RIGHT_PAREN_ORD) /* Differs from ..._POSIX_EXTENDED in that RE_CONTEXT_INVALID_OPS replaces RE_CONTEXT_INDEP_OPS and RE_NO_BK_REFS is added. */ #define RE_SYNTAX_POSIX_MINIMAL_EXTENDED \ (_RE_SYNTAX_POSIX_COMMON | RE_CONTEXT_INDEP_ANCHORS \ | RE_CONTEXT_INVALID_OPS | RE_NO_BK_BRACES \ | RE_NO_BK_PARENS | RE_NO_BK_REFS \ | RE_NO_BK_VBAR | RE_UNMATCHED_RIGHT_PAREN_ORD)
Next: The Backslash Character, Previous: Predefined Syntaxes, Up: Regular Expression Syntax [Contents][Index]
POSIX generalizes the notion of a character to that of a collating element. It defines a collating element to be “a sequence of one or more bytes defined in the current collating sequence as a unit of collation.”
This generalizes the notion of a character in two ways. First, a single character can map into two or more collating elements. For example, the German collates as the collating element ‘s’ followed by another collating element ‘s’. Second, two or more characters can map into one collating element. For example, the Spanish ‘ll’ collates after ‘l’ and before ‘m’.
Since POSIX’s “collating element” preserves the essential idea of a “character,” we use the latter, more familiar, term in this document.
Previous: Collating Elements vs. Characters, Up: Regular Expression Syntax [Contents][Index]
The ‘\’ character has one of four different meanings, depending on the context in which you use it and what syntax bits are set (see Syntax Bits). It can: 1) stand for itself, 2) quote the next character, 3) introduce an operator, or 4) do nothing.
[ … ] and [^ … ])) if the syntax bit
RE_BACKSLASH_ESCAPE_IN_LISTS is not set. For example, ‘[\]’
would match ‘\’.
RE_BACKSLASH_ESCAPE_IN_LISTS is set.
RE_BK_PLUS_QM, RE_NO_BK_BRACES, RE_NO_BK_VAR,
RE_NO_BK_PARENS, RE_NO_BK_REF in Syntax Bits. Also:
\b)).
\B)).
\<)).
\>)).
\w)).
\W)).
emacs
defined, then ‘\sclass’ represents the match-syntactic-class
operator and ‘\Sclass’ represents the
match-not-syntactic-class operator (see Syntactic Class Operators).
Next: GNU Operators, Previous: Regular Expression Syntax, Up: Regular expressions [Contents][Index]
You compose regular expressions from operators. In the following sections, we describe the regular expression operators specified by POSIX; GNU also uses these. Most operators have more than one representation as characters. See Regular Expression Syntax, for what characters represent what operators under what circumstances.
For most operators that can be represented in two ways, one
representation is a single character and the other is that character
preceded by ‘\’. For example, either ‘(’ or ‘\(’
represents the open-group operator. Which one does depends on the
setting of a syntax bit, in this case RE_NO_BK_PARENS. Why is
this so? Historical reasons dictate some of the varying
representations, while POSIX dictates others.
Finally, almost all characters lose any special meaning inside a list
(see List Operators ([ … ] and [^ … ])).
.)| or \|)[ … ] and [^ … ])( … ) or \( … \))
Next: The Match-any-character Operator (.), Up: Common Operators [Contents][Index]
This operator matches the character itself. All ordinary characters (see Regular Expression Syntax) represent this operator. For example, ‘f’ is always an ordinary character, so the regular expression ‘f’ matches only the string ‘f’. In particular, it does not match the string ‘ff’.
Next: The Concatenation Operator, Previous: The Match-self Operator (ordinary character), Up: Common Operators [Contents][Index]
.)This operator matches any single printing or nonprinting character except it won’t match a:
if the syntax bit RE_DOT_NEWLINE isn’t set.
if the syntax bit RE_DOT_NOT_NULL is set.
The ‘.’ (period) character represents this operator. For example, ‘a.b’ matches any three-character string beginning with ‘a’ and ending with ‘b’.
Next: Repetition Operators, Previous: The Match-any-character Operator (.), Up: Common Operators [Contents][Index]
This operator concatenates two regular expressions a and b. No character represents this operator; you simply put b after a. The result is a regular expression that will match a string if a matches its first part and b matches the rest. For example, ‘xy’ (two match-self operators) matches ‘xy’.
Next: The Alternation Operator (| or \|), Previous: The Concatenation Operator, Up: Common Operators [Contents][Index]
Repetition operators repeat the preceding regular expression a specified number of times.
*)+ or \+)? or \?){ … } or \{ … \})*)This operator repeats the smallest possible preceding regular expression as many times as necessary (including zero) to match the pattern. ‘*’ represents this operator. For example, ‘o*’ matches any string made up of zero or more ‘o’s. Since this operator operates on the smallest preceding regular expression, ‘fo*’ has a repeating ‘o’, not a repeating ‘fo’. So, ‘fo*’ matches ‘f’, ‘fo’, ‘foo’, and so on.
Since the match-zero-or-more operator is a suffix operator, it may be useless as such when no regular expression precedes it. This is the case when it:
Three different things can happen in these cases:
RE_CONTEXT_INVALID_OPS is set, then the
regular expression is invalid.
RE_CONTEXT_INVALID_OPS isn’t set, but
RE_CONTEXT_INDEP_OPS is, then ‘*’ represents the
match-zero-or-more operator (which then operates on the empty string).
The matcher processes a match-zero-or-more operator by first matching as many repetitions of the smallest preceding regular expression as it can. Then it continues to match the rest of the pattern.
If it can’t match the rest of the pattern, it backtracks (as many times as necessary), each time discarding one of the matches until it can either match the entire pattern or be certain that it cannot get a match. For example, when matching ‘ca*ar’ against ‘caaar’, the matcher first matches all three ‘a’s of the string with the ‘a*’ of the regular expression. However, it cannot then match the final ‘ar’ of the regular expression against the final ‘r’ of the string. So it backtracks, discarding the match of the last ‘a’ in the string. It can then match the remaining ‘ar’.
Next: The Match-zero-or-one Operator (? or \?), Previous: The Match-zero-or-more Operator (*), Up: Repetition Operators [Contents][Index]
+ or \+)If the syntax bit RE_LIMITED_OPS is set, then Regex doesn’t recognize
this operator. Otherwise, if the syntax bit RE_BK_PLUS_QM isn’t
set, then ‘+’ represents this operator; if it is, then ‘\+’
does.
This operator is similar to the match-zero-or-more operator except that
it repeats the preceding regular expression at least once;
see The Match-zero-or-more Operator (*), for what it operates on, how some
syntax bits affect it, and how Regex backtracks to match it.
For example, supposing that ‘+’ represents the match-one-or-more operator; then ‘ca+r’ matches, e.g., ‘car’ and ‘caaaar’, but not ‘cr’.
Next: Interval Operators ({ … } or \{ … \}), Previous: The Match-one-or-more Operator (+ or \+), Up: Repetition Operators [Contents][Index]
? or \?)If the syntax bit RE_LIMITED_OPS is set, then Regex doesn’t
recognize this operator. Otherwise, if the syntax bit
RE_BK_PLUS_QM isn’t set, then ‘?’ represents this operator;
if it is, then ‘\?’ does.
This operator is similar to the match-zero-or-more operator except that
it repeats the preceding regular expression once or not at all;
see The Match-zero-or-more Operator (*), to see what it operates on, how
some syntax bits affect it, and how Regex backtracks to match it.
For example, supposing that ‘?’ represents the match-zero-or-one operator; then ‘ca?r’ matches both ‘car’ and ‘cr’, but nothing else.
Previous: The Match-zero-or-one Operator (? or \?), Up: Repetition Operators [Contents][Index]
{ … } or \{ … \})If the syntax bit RE_INTERVALS is set, then Regex recognizes
interval expressions. They repeat the smallest possible preceding
regular expression a specified number of times.
If the syntax bit RE_NO_BK_BRACES is set, ‘{’ represents
the open-interval operator and ‘}’ represents the
close-interval operator ; otherwise, ‘\{’ and ‘\}’ do.
Specifically, supposing that ‘{’ and ‘}’ represent the open-interval and close-interval operators; then:
{count}matches exactly count occurrences of the preceding regular expression.
{min,}matches min or more occurrences of the preceding regular expression.
{min, max}matches at least min but no more than max occurrences of the preceding regular expression.
The interval expression (but not necessarily the regular expression that contains it) is invalid if:
RE_DUP_MAX (which symbol regex.h
defines).
If the interval expression is invalid and the syntax bit
RE_NO_BK_BRACES is set, then Regex considers all the
characters in the would-be interval to be ordinary. If that bit
isn’t set, then the regular expression is invalid.
If the interval expression is valid but there is no preceding regular
expression on which to operate, then if the syntax bit
RE_CONTEXT_INVALID_OPS is set, the regular expression is invalid.
If that bit isn’t set, then Regex considers all the characters—other
than backslashes, which it ignores—in the would-be interval to be
ordinary.
Next: List Operators ([ … ] and [^ … ]), Previous: Repetition Operators, Up: Common Operators [Contents][Index]
| or \|)If the syntax bit RE_LIMITED_OPS is set, then Regex doesn’t
recognize this operator. Otherwise, if the syntax bit
RE_NO_BK_VBAR is set, then ‘|’ represents this operator;
otherwise, ‘\|’ does.
Alternatives match one of a choice of regular expressions: if you put the character(s) representing the alternation operator between any two regular expressions a and b, the result matches the union of the strings that a and b match. For example, supposing that ‘|’ is the alternation operator, then ‘foo|bar|quux’ would match any of ‘foo’, ‘bar’ or ‘quux’.
The alternation operator operates on the largest possible surrounding regular expressions. (Put another way, it has the lowest precedence of any regular expression operator.) Thus, the only way you can delimit its arguments is to use grouping. For example, if ‘(’ and ‘)’ are the open and close-group operators, then ‘fo(o|b)ar’ would match either ‘fooar’ or ‘fobar’. (‘foo|bar’ would match ‘foo’ or ‘bar’.)
The matcher usually tries all combinations of alternatives so as to match the longest possible string. For example, when matching ‘(fooq|foo)*(qbarquux|bar)’ against ‘fooqbarquux’, it cannot take, say, the first (“depth-first”) combination it could match, since then it would be content to match just ‘fooqbar’.
Note that since the default behavior is to return the leftmost longest match, when more than one of a series of alternatives matches the actual match will be the longest matching alternative, not necessarily the first in the list.
Next: Grouping Operators (( … ) or \( … \)), Previous: The Alternation Operator (| or \|), Up: Common Operators [Contents][Index]
[ … ] and [^ … ])Lists, also called bracket expressions, are a set of one or more items. An item is a character, a collating symbol, an equivalence class expression, a character class expression, or a range expression. The syntax bits affect which kinds of items you can put in a list. We explain the last four items in subsections below. Empty lists are invalid.
A matching list matches a single character represented by one of the list items. You form a matching list by enclosing one or more items within an open-matching-list operator (represented by ‘[’) and a close-list operator (represented by ‘]’).
For example, ‘[ab]’ matches either ‘a’ or ‘b’. ‘[ad]*’ matches the empty string and any string composed of just ‘a’s and ‘d’s in any order. Regex considers invalid a regular expression with a ‘[’ but no matching ‘]’.
Nonmatching lists are similar to matching lists except that they match a single character not represented by one of the list items. You use an open-nonmatching-list operator (represented by ‘[^’2) instead of an open-matching-list operator to start a nonmatching list.
For example, ‘[^ab]’ matches any character except ‘a’ or ‘b’.
If the syntax bit RE_HAT_LISTS_NOT_NEWLINE is set, then
nonmatching lists do not match a newline.
Most characters lose any special meaning inside a list. The special characters inside a list follow.
ends the list if it’s not the first list item. So, if you want to make the ‘]’ character a list item, you must put it first.
quotes the next character if the syntax bit RE_BACKSLASH_ESCAPE_IN_LISTS is
set.
represents the open-collating-symbol operator (see Collating Symbol Operators ([. … .])).
represents the close-collating-symbol operator.
represents the open-equivalence-class operator (see Equivalence Class Operators ([= … =])).
represents the close-equivalence-class operator.
represents the open-character-class operator (see Character Class Operators ([: … :])) if the syntax bit RE_CHAR_CLASSES is set and what
follows is a valid character class expression.
represents the close-character-class operator if the syntax bit
RE_CHAR_CLASSES is set and what precedes it is an
open-character-class operator followed by a valid character class name.
represents the range operator (see The Range Operator (-)) if it’s
not first or last in a list or the ending point of a range.
All other characters are ordinary. For example, ‘[.*]’ matches ‘.’ and ‘*’.
[. … .])[= … =])[: … :])-)
Next: Equivalence Class Operators ([= … =]), Up: List Operators ([ … ] and [^ … ]) [Contents][Index]
[. … .])Collating symbols can be represented inside lists. You form a collating symbol by putting a collating element between an open-collating-symbol operator and a close-collating-symbol operator. ‘[.’ represents the open-collating-symbol operator and ‘.]’ represents the close-collating-symbol operator. For example, if ‘ll’ is a collating element, then ‘[[.ll.]]’ would match ‘ll’.
Next: Character Class Operators ([: … :]), Previous: Collating Symbol Operators ([. … .]), Up: List Operators ([ … ] and [^ … ]) [Contents][Index]
[= … =])Regex recognizes equivalence class expressions inside lists. A equivalence class expression is a set of collating elements which all belong to the same equivalence class. You form an equivalence class expression by putting a collating element between an open-equivalence-class operator and a close-equivalence-class operator. ‘[=’ represents the open-equivalence-class operator and ‘=]’ represents the close-equivalence-class operator. For example, if ‘a’ and ‘A’ were an equivalence class, then both ‘[[=a=]]’ and ‘[[=A=]]’ would match both ‘a’ and ‘A’. If the collating element in an equivalence class expression isn’t part of an equivalence class, then the matcher considers the equivalence class expression to be a collating symbol.
Next: The Range Operator (-), Previous: Equivalence Class Operators ([= … =]), Up: List Operators ([ … ] and [^ … ]) [Contents][Index]
[: … :])If the syntax bit RE_CHAR_CLASSES is set, then Regex recognizes
character class expressions inside lists. A character class
expression matches one character from a given class. You form a
character class expression by putting a character class name between
an open-character-class operator (represented by ‘[:’) and
a close-character-class operator (represented by ‘:]’).
The character class names and their meanings are:
alnumletters and digits
alphaletters
blanksystem-dependent; for GNU, a space or tab
cntrlcontrol characters (in the ASCII encoding, code 0177 and codes less than 040)
digitdigits
graphsame as print except omits space
lowerlowercase letters
printprintable characters (in the ASCII encoding, space tilde—codes 040 through 0176)
punctneither control nor alphanumeric characters
spacespace, carriage return, newline, vertical tab, and form feed
upperuppercase letters
xdigithexadecimal digits: 0–9, a–f, A–F
These correspond to the definitions in the C library’s <ctype.h>
facility. For example, ‘[:alpha:]’ corresponds to the standard
facility isalpha. Regex recognizes character class expressions
only inside of lists; so ‘[[:alpha:]]’ matches any letter, but
‘[:alpha:]’ outside of a bracket expression and not followed by a
repetition operator matches just itself.
Previous: Character Class Operators ([: … :]), Up: List Operators ([ … ] and [^ … ]) [Contents][Index]
-)Regex recognizes range expressions inside a list. They represent those characters that fall between two elements in the current collating sequence. You form a range expression by putting a range operator between two of any of the following: characters, collating elements, collating symbols, and equivalence class expressions. The starting point of the range and the ending point of the range don’t have to be the same kind of item, e.g., the starting point could be a collating element and the ending point could be an equivalence class expression. If a range’s ending point is an equivalence class, then all the collating elements in that class will be in the range.3 ‘-’ represents the range operator. For example, ‘a-f’ within a list represents all the characters from ‘a’ through ‘f’ inclusively.
If the syntax bit RE_NO_EMPTY_RANGES is set, then if the range’s
ending point collates less than its starting point, the range (and the
regular expression containing it) is invalid. For example, the regular
expression ‘[z-a]’ would be invalid. If this bit isn’t set, then
Regex considers such a range to be empty.
Since ‘-’ represents the range operator, if you want to make a ‘-’ character itself a list item, you must do one of the following:
For example, ‘[-a-z]’ matches a lowercase letter or a hyphen (in English, in ASCII).
Next: The Back-reference Operator (\digit), Previous: List Operators ([ … ] and [^ … ]), Up: Common Operators [Contents][Index]
( … ) or \( … \))A group, also known as a subexpression, consists of an open-group operator, any number of other operators, and a close-group operator. Regex treats this sequence as a unit, just as mathematics and programming languages treat a parenthesized expression as a unit.
Therefore, using groups, you can:
| or \|)) or a repetition operator (see Repetition Operators).
If the syntax bit RE_NO_BK_PARENS is set, then ‘(’ represents
the open-group operator and ‘)’ represents the
close-group operator; otherwise, ‘\(’ and ‘\)’ do.
If the syntax bit RE_UNMATCHED_RIGHT_PAREN_ORD is set and a
close-group operator has no matching open-group operator, then Regex
considers it to match ‘)’.
Next: Anchoring Operators, Previous: Grouping Operators (( … ) or \( … \)), Up: Common Operators [Contents][Index]
If the syntax bit RE_NO_BK_REF isn’t set, then Regex recognizes
back references. A back reference matches a specified preceding group.
The back reference operator is represented by ‘\digit’
anywhere after the end of a regular expression’s digit-th
group (see Grouping Operators (( … ) or \( … \))).
digit must be between ‘1’ and ‘9’. The matcher assigns numbers 1 through 9 to the first nine groups it encounters. By using one of ‘\1’ through ‘\9’ after the corresponding group’s close-group operator, you can match a substring identical to the one that the group does.
Back references match according to the following (in all examples below, ‘(’ represents the open-group, ‘)’ the close-group, ‘{’ the open-interval and ‘}’ the close-interval operator):
RE_DOT_NEWLINE isn’t set) string that is composed of two
identical halves; the ‘(.*)’ matches the first half and the
‘\1’ matches the second half.
You can use a back reference as an argument to a repetition operator. For example, ‘(a(b))\2*’ matches ‘a’ followed by two or more ‘b’s. Similarly, ‘(a(b))\2{3}’ matches ‘abbbb’.
If there is no preceding digit-th subexpression, the regular expression is invalid.
Previous: The Back-reference Operator (\digit), Up: Common Operators [Contents][Index]
These operators can constrain a pattern to match only at the beginning or end of the entire string or at the beginning or end of a line.
Next: The Match-end-of-line Operator ($), Up: Anchoring Operators [Contents][Index]
^)This operator can match the empty string either at the beginning of the string or after a newline character. Thus, it is said to anchor the pattern to the beginning of a line.
In the cases following, ‘^’ represents this operator. (Otherwise, ‘^’ is ordinary.)
RE_CONTEXT_INDEP_ANCHORS is set, and it is outside
a bracket expression.
( … ) or \( … \)), and The Alternation Operator (| or \|).
These rules imply that some valid patterns containing ‘^’ cannot be
matched; for example, ‘foo^bar’ if RE_CONTEXT_INDEP_ANCHORS
is set.
If the not_bol field is set in the pattern buffer (see GNU Pattern Buffers), then ‘^’ fails to match at the beginning of the
string. This lets you match against pieces of a line, as you would need to if,
say, searching for repeated instances of a given pattern in a line; it
would work correctly for patterns both with and without
match-beginning-of-line operators.
Previous: The Match-beginning-of-line Operator (^), Up: Anchoring Operators [Contents][Index]
$)This operator can match the empty string either at the end of the string or before a newline character in the string. Thus, it is said to anchor the pattern to the end of a line.
It is always represented by ‘$’. For example, ‘foo$’ usually matches, e.g., ‘foo’ and, e.g., the first three characters of ‘foo\nbar’.
Its interaction with the syntax bits and pattern buffer fields is
exactly the dual of ‘^’’s; see the previous section. (That is,
“‘^’” becomes “‘$’”, “beginning” becomes “end”,
“next” becomes “previous”, “after” becomes “before”, and
“not_bol” becomes “not_eol”.)
Next: GNU Emacs Operators, Previous: Common Operators, Up: Regular expressions [Contents][Index]
Following are operators that GNU defines (and POSIX doesn’t).
Next: Buffer Operators, Up: GNU Operators [Contents][Index]
The operators in this section require Regex to recognize parts of words. Regex uses a syntax table to determine whether or not a character is part of a word, i.e., whether or not it is word-constituent.
\b)\B)\<)\>)\w)\W)
Next: The Match-word-boundary Operator (\b), Up: Word Operators [Contents][Index]
A syntax table is an array indexed by the characters in your
character set. In the ASCII encoding, therefore, a syntax table
has 256 elements. Regex always uses a char * variable
re_syntax_table as its syntax table. In some cases, it
initializes this variable and in others it expects you to initialize it.
emacs and
SYNTAX_TABLE both undefined, then Regex allocates
re_syntax_table and initializes an element i either to
Sword (which it defines) if i is a letter, number, or
‘_’, or to zero if it’s not.
emacs undefined but SYNTAX_TABLE
defined, then Regex expects you to define a char * variable
re_syntax_table to be a valid syntax table.
emacs defined.
Next: The Match-within-word Operator (\B), Previous: Non-Emacs Syntax Tables, Up: Word Operators [Contents][Index]
\b)This operator (represented by ‘\b’) matches the empty string at either the beginning or the end of a word. For example, ‘\brat\b’ matches the separate word ‘rat’.
Next: The Match-beginning-of-word Operator (\<), Previous: The Match-word-boundary Operator (\b), Up: Word Operators [Contents][Index]
\B)This operator (represented by ‘\B’) matches the empty string within a word. For example, ‘c\Brat\Be’ matches ‘crate’, but ‘dirty \Brat’ doesn’t match ‘dirty rat’.
Next: The Match-end-of-word Operator (\>), Previous: The Match-within-word Operator (\B), Up: Word Operators [Contents][Index]
\<)This operator (represented by ‘\<’) matches the empty string at the beginning of a word.
Next: The Match-word-constituent Operator (\w), Previous: The Match-beginning-of-word Operator (\<), Up: Word Operators [Contents][Index]
\>)This operator (represented by ‘\>’) matches the empty string at the end of a word.
Next: The Match-non-word-constituent Operator (\W), Previous: The Match-end-of-word Operator (\>), Up: Word Operators [Contents][Index]
\w)This operator (represented by ‘\w’) matches any word-constituent character.
Previous: The Match-word-constituent Operator (\w), Up: Word Operators [Contents][Index]
\W)This operator (represented by ‘\W’) matches any character that is not word-constituent.
Previous: Word Operators, Up: GNU Operators [Contents][Index]
Following are operators which work on buffers. In Emacs, a buffer is, naturally, an Emacs buffer. For other programs, Regex considers the entire string to be matched as the buffer.
Next: The Match-end-of-buffer Operator (\'), Up: Buffer Operators [Contents][Index]
\`)This operator (represented by ‘\`’) matches the empty string at the beginning of the buffer.
Previous: The Match-beginning-of-buffer Operator (\`), Up: Buffer Operators [Contents][Index]
\')This operator (represented by ‘\'’) matches the empty string at the end of the buffer.
Next: What Gets Matched?, Previous: GNU Operators, Up: Regular expressions [Contents][Index]
Following are operators that GNU defines (and POSIX doesn’t)
that you can use only when Regex is compiled with the preprocessor
symbol emacs defined.
Up: GNU Emacs Operators [Contents][Index]
The operators in this section require Regex to recognize the syntactic classes of characters. Regex uses a syntax table to determine this.
\sclass)\Sclass)A syntax table is an array indexed by the characters in your character set. In the ASCII encoding, therefore, a syntax table has 256 elements.
If Regex is compiled with the preprocessor symbol emacs defined,
then Regex expects you to define and initialize the variable
re_syntax_table to be an Emacs syntax table. Emacs’ syntax
tables are more complicated than Regex’s own (see Non-Emacs Syntax Tables). See Syntax in The GNU Emacs User’s Manual,
for a description of Emacs’ syntax tables.
Next: The Match-not-syntactic-class Operator (\Sclass), Previous: Emacs Syntax Tables, Up: Syntactic Class Operators [Contents][Index]
\sclass)This operator matches any character whose syntactic class is represented by a specified character. ‘\sclass’ represents this operator where class is the character representing the syntactic class you want. For example, ‘w’ represents the syntactic class of word-constituent characters, so ‘\sw’ matches any word-constituent character.
Previous: The Match-syntactic-class Operator (\sclass), Up: Syntactic Class Operators [Contents][Index]
\Sclass)This operator is similar to the match-syntactic-class operator except that it matches any character whose syntactic class is not represented by the specified character. ‘\Sclass’ represents this operator. For example, ‘w’ represents the syntactic class of word-constituent characters, so ‘\Sw’ matches any character that is not word-constituent.
Next: Programming with Regex, Previous: GNU Emacs Operators, Up: Regular expressions [Contents][Index]
Regex usually matches strings according to the “leftmost longest” rule; that is, it chooses the longest of the leftmost matches. This does not mean that for a regular expression containing subexpressions that it simply chooses the longest match for each subexpression, left to right; the overall match must also be the longest possible one.
For example, ‘(ac*)(c*d[ac]*)\1’ matches ‘acdacaaa’, not ‘acdac’, as it would if it were to choose the longest match for the first subexpression.
Next: Regular expression syntaxes, Previous: What Gets Matched?, Up: Regular expressions [Contents][Index]
Here we describe how you use the Regex data structures and functions in C programs. Regex has three interfaces: one designed for GNU, one compatible with POSIX (as specified by POSIX, draft 1003.2/D11.2), and one compatible with Berkeley Unix. The POSIX interface is not documented here; see the documentation of GNU libc, or the POSIX man pages. The Berkeley Unix interface is documented here for convenience, since its documentation is not otherwise readily available on GNU systems.
Next: BSD Regex Functions, Up: Programming with Regex [Contents][Index]
If you’re writing code that doesn’t need to be compatible with either POSIX or Berkeley Unix, you can use these functions. They provide more options than the other interfaces.
Next: GNU Regular Expression Compiling, Up: GNU Regex Functions [Contents][Index]
To compile, match, or search for a given regular expression, you must supply a pattern buffer. A pattern buffer holds one compiled regular expression.4
You can have several different pattern buffers simultaneously, each holding a compiled pattern for a different regular expression.
regex.h defines the pattern buffer struct with the
following public fields:
unsigned char *buffer; unsigned long allocated; char *fastmap; char *translate; size_t re_nsub; unsigned no_sub : 1; unsigned not_bol : 1; unsigned not_eol : 1;
Next: GNU Matching, Previous: GNU Pattern Buffers, Up: GNU Regex Functions [Contents][Index]
In GNU, you can both match and search for a given regular expression. To do either, you must first compile it in a pattern buffer (see GNU Pattern Buffers).
Regular expressions match according to the syntax with which they were
compiled; with GNU, you indicate what syntax you want by setting
the variable re_syntax_options (declared in regex.h)
before calling the compiling function, re_compile_pattern (see
below). See Syntax Bits, and Predefined Syntaxes.
You can change the value of re_syntax_options at any time.
Usually, however, you set its value once and then never change it.
re_compile_pattern takes a pattern buffer as an argument. You
must initialize the following fields:
translate initializationtranslate ¶Initialize this to point to a translate table if you want one, or to zero if you don’t. We explain translate tables in GNU Translate Tables.
fastmap ¶Initialize this to nonzero if you want a fastmap, or to zero if you don’t.
buffer ¶allocatedIf you want re_compile_pattern to allocate memory for the
compiled pattern, set both of these to zero. If you have an existing
block of memory (allocated with malloc) you want Regex to use,
set buffer to its address and allocated to its size (in
bytes).
re_compile_pattern uses realloc to extend the space for
the compiled pattern as necessary.
To compile a pattern buffer, use:
char *
re_compile_pattern (const char *regex, const int regex_size,
struct re_pattern_buffer *pattern_buffer)
regex is the regular expression’s address, regex_size is its length, and pattern_buffer is the pattern buffer’s address.
If re_compile_pattern successfully compiles the regular
expression, it returns zero and sets *pattern_buffer to the
compiled pattern. It sets the pattern buffer’s fields as follows:
buffer ¶to the compiled pattern.
syntax ¶to the current value of re_syntax_options.
re_nsub ¶to the number of subexpressions in regex.
If re_compile_pattern can’t compile regex, it returns an
error string corresponding to a POSIX error code.
Next: GNU Searching, Previous: GNU Regular Expression Compiling, Up: GNU Regex Functions [Contents][Index]
Matching the GNU way means trying to match as much of a string as possible starting at a position within it you specify. Once you’ve compiled a pattern into a pattern buffer (see GNU Regular Expression Compiling), you can ask the matcher to match that pattern against a string using:
int
re_match (struct re_pattern_buffer *pattern_buffer,
const char *string, const int size,
const int start, struct re_registers *regs)
pattern_buffer is the address of a pattern buffer containing a compiled pattern. string is the string you want to match; it can contain newline and null characters. size is the length of that string. start is the string index at which you want to begin matching; the first character of string is at index zero. See Using Registers, for an explanation of regs; you can safely pass zero.
re_match matches the regular expression in pattern_buffer
against the string string according to the syntax of
pattern_buffer. (See GNU Regular Expression Compiling, for how
to set it.) The function returns -1 if the compiled pattern does
not match any part of string and -2 if an internal error
happens; otherwise, it returns how many (possibly zero) characters of
string the pattern matched.
An example: suppose pattern_buffer points to a pattern buffer
containing the compiled pattern for ‘a*’, and string points
to ‘aaaaab’ (whereupon size should be 6). Then if start
is 2, re_match returns 3, i.e., ‘a*’ would have matched the
last three ‘a’s in string. If start is 0,
re_match returns 5, i.e., ‘a*’ would have matched all the
‘a’s in string. If start is either 5 or 6, it returns
zero.
If start is not between zero and size, then
re_match returns -1.
Next: Matching and Searching with Split Data, Previous: GNU Matching, Up: GNU Regex Functions [Contents][Index]
Searching means trying to match starting at successive positions
within a string. The function re_search does this.
Before calling re_search, you must compile your regular
expression. See GNU Regular Expression Compiling.
Here is the function declaration:
int
re_search (struct re_pattern_buffer *pattern_buffer,
const char *string, const int size,
const int start, const int range,
struct re_registers *regs)
whose arguments are the same as those to re_match (see GNU Matching) except that the two arguments start and range
replace re_match’s argument start.
If range is positive, then re_search attempts a match
starting first at index start, then at start + 1 if
that fails, and so on, up to start + range; if
range is negative, then it attempts a match starting first at
index start, then at start -1 if that fails, and so
on.
If start is not between zero and size, then re_search
returns -1. When range is positive, re_search
adjusts range so that start + range - 1 is
between zero and size, if necessary; that way it won’t search
outside of string. Similarly, when range is negative,
re_search adjusts range so that start +
range + 1 is between zero and size, if necessary.
If the fastmap field of pattern_buffer is zero,
re_search matches starting at consecutive positions; otherwise,
it uses fastmap to make the search more efficient.
See Searching with Fastmaps.
If no match is found, re_search returns -1. If
a match is found, it returns the index where the match began. If an
internal error happens, it returns -2.
Next: Searching with Fastmaps, Previous: GNU Searching, Up: GNU Regex Functions [Contents][Index]
Using the functions re_match_2 and re_search_2, you can
match or search in data that is divided into two strings.
The function:
int
re_match_2 (struct re_pattern_buffer *buffer,
const char *string1, const int size1,
const char *string2, const int size2,
const int start,
struct re_registers *regs,
const int stop)
is similar to re_match (see GNU Matching) except that you
pass two data strings and sizes, and an index stop beyond
which you don’t want the matcher to try matching. As with
re_match, if it succeeds, re_match_2 returns how many
characters of string it matched. Regard string1 and
string2 as concatenated when you set the arguments start and
stop and use the contents of regs; re_match_2 never
returns a value larger than size1 + size2.
The function:
int
re_search_2 (struct re_pattern_buffer *buffer,
const char *string1, const int size1,
const char *string2, const int size2,
const int start, const int range,
struct re_registers *regs,
const int stop)
is similarly related to re_search.
Next: GNU Translate Tables, Previous: Matching and Searching with Split Data, Up: GNU Regex Functions [Contents][Index]
If you’re searching through a long string, you should use a fastmap. Without one, the searcher tries to match at consecutive positions in the string. Generally, most of the characters in the string could not start a match. It takes much longer to try matching at a given position in the string than it does to check in a table whether or not the character at that position could start a match. A fastmap is such a table.
More specifically, a fastmap is an array indexed by the characters in
your character set. Under the ASCII encoding, therefore, a fastmap
has 256 elements. If you want the searcher to use a fastmap with a
given pattern buffer, you must allocate the array and assign the array’s
address to the pattern buffer’s fastmap field. You either can
compile the fastmap yourself or have re_search do it for you;
when fastmap is nonzero, it automatically compiles a fastmap the
first time you search using a particular compiled pattern.
By setting the buffer’s fastmap field before calling
re_compile_pattern, you can reuse a buffer data structure across
multiple searches with different patterns, and allocate the fastmap only
once. Nonetheless, the fastmap must be recompiled each time the buffer
has a new pattern compiled into it.
To compile a fastmap yourself, use:
int re_compile_fastmap (struct re_pattern_buffer *pattern_buffer)
pattern_buffer is the address of a pattern buffer. If the
character c could start a match for the pattern,
re_compile_fastmap makes
pattern_buffer->fastmap[c] nonzero. It returns
0 if it can compile a fastmap and -2 if there is an
internal error. For example, if ‘|’ is the alternation operator
and pattern_buffer holds the compiled pattern for ‘a|b’, then
re_compile_fastmap sets fastmap['a'] and
fastmap['b'] (and no others).
re_search uses a fastmap as it moves along in the string: it
checks the string’s characters until it finds one that’s in the fastmap.
Then it tries matching at that character. If the match fails, it
repeats the process. So, by using a fastmap, re_search doesn’t
waste time trying to match at positions in the string that couldn’t
start a match.
If you don’t want re_search to use a fastmap,
store zero in the fastmap field of the pattern buffer before
calling re_search.
Once you’ve initialized a pattern buffer’s fastmap field, you
need never do so again—even if you compile a new pattern in
it—provided the way the field is set still reflects whether or not you
want a fastmap. re_search will still either do nothing if
fastmap is null or, if it isn’t, compile a new fastmap for the
new pattern.
Next: Using Registers, Previous: Searching with Fastmaps, Up: GNU Regex Functions [Contents][Index]
If you set the translate field of a pattern buffer to a translate
table, then the GNU Regex functions to which you’ve passed that
pattern buffer use it to apply a simple transformation
to all the regular expression and string characters at which they look.
A translate table is an array indexed by the characters in your
character set. Under the ASCII encoding, therefore, a translate
table has 256 elements. The array’s elements are also characters in
your character set. When the Regex functions see a character c,
they use translate[c] in its place, with one exception: the
character after a ‘\’ is not translated. (This ensures that, the
operators, e.g., ‘\B’ and ‘\b’, are always distinguishable.)
For example, a table that maps all lowercase letters to the
corresponding uppercase ones would cause the matcher to ignore
differences in case.5 Such a table would map all characters except lowercase letters
to themselves, and lowercase letters to the corresponding uppercase
ones. Under the ASCII encoding, here’s how you could initialize
such a table (we’ll call it case_fold):
for (i = 0; i < 256; i++)
case_fold[i] = i;
for (i = 'a'; i <= 'z'; i++)
case_fold[i] = i - ('a' - 'A');
You tell Regex to use a translate table on a given pattern buffer by
assigning that table’s address to the translate field of that
buffer. If you don’t want Regex to do any translation, put zero into
this field. You’ll get weird results if you change the table’s contents
anytime between compiling the pattern buffer, compiling its fastmap, and
matching or searching with the pattern buffer.
Next: Freeing GNU Pattern Buffers, Previous: GNU Translate Tables, Up: GNU Regex Functions [Contents][Index]
A group in a regular expression can match a (possibly empty) substring of the string that regular expression as a whole matched. The matcher remembers the beginning and end of the substring matched by each group.
To find out what they matched, pass a nonzero regs argument to a GNU matching or searching function (see GNU Matching and GNU Searching), i.e., the address of a structure of this type, as defined in regex.h:
struct re_registers
{
unsigned num_regs;
regoff_t *start;
regoff_t *end;
};
Except for (possibly) the num_regs’th element (see below), the
ith element of the start and end arrays records
information about the ith group in the pattern. (They’re declared
as C pointers, but this is only because not all C compilers accept
zero-length arrays; conceptually, it is simplest to think of them as
arrays.)
The start and end arrays are allocated in one of two ways.
The simplest and perhaps most useful is to let the matcher (re)allocate
enough space to record information for all the groups in the regular
expression. If re_set_registers is not called before searching
or matching, then the matcher allocates two arrays each of 1 +
re_nsub elements (re_nsub is another field in the pattern
buffer; see GNU Pattern Buffers). The extra element is set to
-1. Then on subsequent calls with the same pattern buffer and
regs arguments, the matcher reallocates more space if necessary.
The function:
void
re_set_registers (struct re_pattern_buffer *buffer,
struct re_registers *regs,
size_t num_regs,
regoff_t *starts, regoff_t *ends)
sets regs to hold num_regs registers, storing
them in starts and ends. Subsequent matches using
buffer and regs will use this memory for recording
register information. starts and ends must be allocated
with malloc, and must each be at least num_regs *
sizeof (regoff_t) bytes long.
If num_regs is zero, then subsequent matches should allocate their own register data.
Unless this function is called, the first search or match using buffer will allocate its own register data, without freeing the old data.
The following examples illustrate the information recorded in the
re_registers structure. (In all of them, ‘(’ represents the
open-group and ‘)’ the close-group operator. The first character
in the string string is at index 0.)
regs->start[i] to the index in string where
the substring matched by the i-th group begins, and
regs->end[i] to the index just beyond that
substring’s end. The function sets regs->start[0] and
regs->end[0] to analogous information about the entire
pattern.
For example, when you match ‘((a)(b))’ against ‘ab’, you get:
regs->start[0] and 2 in regs->end[0]
regs->start[1] and 2 in regs->end[1]
regs->start[2] and 1 in regs->end[2]
regs->start[3] and 2 in regs->end[3]
For example, when you match the pattern ‘(a)*’ against the string ‘aa’, you get:
regs->start[0] and 2 in regs->end[0]
regs->start[1] and 2 in regs->end[1]
regs->start[i] and
regs->end[i] to -1.
For example, when you match the pattern ‘(a)*b’ against the string ‘b’, you get:
regs->start[0] and 1 in regs->end[0]
regs->start[1] and -1 in regs->end[1]
regs->start[i] and
regs->end[i] to the index just beyond that
zero-length string.
For example, when you match the pattern ‘(a*)b’ against the string ‘b’, you get:
regs->start[0] and 1 in regs->end[0]
regs->start[1] and 0 in regs->end[1]
regs->start[j] and
regs->end[j] the last match (if it matched) of
the j-th group.
For example, when you match the pattern ‘((a*)b)*’ against the string ‘abb’, group 2 last matches the empty string, so you get what it previously matched:
regs->start[0] and 3 in regs->end[0]
regs->start[1] and 3 in regs->end[1]
regs->start[2] and 2 in regs->end[2]
When you match the pattern ‘((a)*b)*’ against the string ‘abb’, group 2 doesn’t participate in the last match, so you get:
regs->start[0] and 3 in regs->end[0]
regs->start[1] and 3 in regs->end[1]
regs->start[2] and 1 in regs->end[2]
regs->start[i] and
regs->end[i] to -1, then it also sets
regs->start[j] and
regs->end[j] to -1.
For example, when you match the pattern ‘((a)*b)*c’ against the string ‘c’, you get:
regs->start[0] and 1 in regs->end[0]
regs->start[1] and -1 in regs->end[1]
regs->start[2] and -1 in regs->end[2]
Previous: Using Registers, Up: GNU Regex Functions [Contents][Index]
To free any allocated fields of a pattern buffer, use the POSIX
function regfree:
void regfree (regex_t *preg)
preg is the pattern buffer whose allocated fields you want freed;
this works because since the type regex_t—the type for
POSIX pattern buffers—is equivalent to the type
re_pattern_buffer.
regfree also sets preg’s allocated field to zero.
After a buffer has been freed, it must have a regular expression
compiled in it before passing it to a matching or searching function.
Previous: GNU Regex Functions, Up: Programming with Regex [Contents][Index]
If you’re writing code that has to be Berkeley Unix compatible, you’ll need to use these functions whose interfaces are the same as those in Berkeley Unix.
Next: BSD Searching, Up: BSD Regex Functions [Contents][Index]
With Berkeley Unix, you can only search for a given regular
expression; you can’t match one. To search for it, you must first
compile it. Before you compile it, you must indicate the regular
expression syntax you want it compiled according to by setting the
variable re_syntax_options (declared in regex.h to some
syntax (see Regular Expression Syntax).
To compile a regular expression use:
char * re_comp (char *regex)
regex is the address of a null-terminated regular expression.
re_comp uses an internal pattern buffer, so you can use only the
most recently compiled pattern buffer. This means that if you want to
use a given regular expression that you’ve already compiled—but it
isn’t the latest one you’ve compiled—you’ll have to recompile it. If
you call re_comp with the null string (not the empty
string) as the argument, it doesn’t change the contents of the pattern
buffer.
If re_comp successfully compiles the regular expression, it
returns zero. If it can’t compile the regular expression, it returns
an error string. re_comp’s error messages are identical to those
of re_compile_pattern (see GNU Regular Expression Compiling).
Previous: BSD Regular Expression Compiling, Up: BSD Regex Functions [Contents][Index]
Searching the Berkeley Unix way means searching in a string
starting at its first character and trying successive positions within
it to find a match. Once you’ve compiled a pattern using re_comp
(see BSD Regular Expression Compiling), you can ask Regex
to search for that pattern in a string using:
int re_exec (char *string)
string is the address of the null-terminated string in which you want to search.
re_exec returns either 1 for success or 0 for failure. It
automatically uses a GNU fastmap (see Searching with Fastmaps).
Previous: Programming with Regex, Up: Regular expressions [Contents][Index]
Gnulib supports many different types of regular expressions; although the underlying features are the same or identical, the syntax used varies. The descriptions given here for the different types are generated automatically.
The character ‘.’ matches any single character except the null character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ can be used to quote the following character. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are not supported and so ‘\w’, ‘\W’, ‘\<’, ‘\>’, ‘\b’, ‘\B’, ‘\`’, and ‘\'’ match ‘w’, ‘W’, ‘<’, ‘>’, ‘b’, ‘B’, ‘`’, and ‘'’ respectively.
Grouping is performed with parentheses ‘()’. An unmatched ‘)’ matches just itself. A backslash followed by a digit matches that digit.
The alternation operator is ‘|’.
The characters ‘^’ and ‘$’ always represent the beginning and end of a string respectively, except within square brackets. Within brackets, ‘^’ can be used to invert the membership of the character class being specified.
‘*’, ‘+’ and ‘?’ are special at any point in a regular expression except:
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘ed’ regular expression syntax, Previous: ‘awk’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ is taken literally. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with parentheses ‘()’. An unmatched ‘)’ matches just itself. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘(’.
The alternation operator is ‘|’.
The characters ‘^’ and ‘$’ always represent the beginning and end of a string respectively, except within square brackets. Within brackets, ‘^’ can be used to invert the membership of the character class being specified.
The characters ‘*’, ‘+’ and ‘?’ are special anywhere in a regular expression.
Intervals are specified by ‘{’ and ‘}’. Invalid intervals are treated as literals, for example ‘a{1’ is treated as ‘a\{1’
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘emacs’ regular expression syntax, Previous: ‘egrep’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character except the null character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
match themselves.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ is taken literally. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with backslashes followed by parentheses ‘\(’, ‘\)’. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘\(’.
The alternation operator is ‘\|’.
The character ‘^’ only represents the beginning of a string when it appears:
The character ‘$’ only represents the end of a string when it appears:
‘\*’, ‘\+’ and ‘\?’ are special at any point in a regular expression except:
Intervals are specified by ‘\{’ and ‘\}’. Invalid intervals such as ‘a\{1z’ are not accepted.
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘gnu-awk’ regular expression syntax, Previous: ‘ed’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character except newline.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are ignored. Within square brackets, ‘\’ is taken literally. Character classes are not supported, so for example you would need to use ‘[0-9]’ instead of ‘[[:digit:]]’.
GNU extensions are supported:
Grouping is performed with backslashes followed by parentheses ‘\(’, ‘\)’. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘\(’.
The alternation operator is ‘\|’.
The character ‘^’ only represents the beginning of a string when it appears:
The character ‘$’ only represents the end of a string when it appears:
‘*’, ‘+’ and ‘?’ are special at any point in a regular expression except:
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘grep’ regular expression syntax, Previous: ‘emacs’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ can be used to quote the following character. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with parentheses ‘()’. An unmatched ‘)’ matches just itself. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘(’.
The alternation operator is ‘|’.
The characters ‘^’ and ‘$’ always represent the beginning and end of a string respectively, except within square brackets. Within brackets, ‘^’ can be used to invert the membership of the character class being specified.
‘*’, ‘+’ and ‘?’ are special at any point in a regular expression except:
Intervals are specified by ‘{’ and ‘}’. Invalid intervals are treated as literals, for example ‘a{1’ is treated as ‘a\{1’
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘posix-awk’ regular expression syntax, Previous: ‘gnu-awk’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
match themselves.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ is taken literally. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with backslashes followed by parentheses ‘\(’, ‘\)’. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘\(’.
The alternation operator is ‘\|’.
The character ‘^’ only represents the beginning of a string when it appears:
The character ‘$’ only represents the end of a string when it appears:
‘\*’, ‘\+’ and ‘\?’ are special at any point in a regular expression except:
Intervals are specified by ‘\{’ and ‘\}’. Invalid intervals such as ‘a\{1z’ are not accepted.
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘posix-basic’ regular expression syntax, Previous: ‘grep’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character except the null character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ can be used to quote the following character. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are not supported and so ‘\w’, ‘\W’, ‘\<’, ‘\>’, ‘\b’, ‘\B’, ‘\`’, and ‘\'’ match ‘w’, ‘W’, ‘<’, ‘>’, ‘b’, ‘B’, ‘`’, and ‘'’ respectively.
Grouping is performed with parentheses ‘()’. An unmatched ‘)’ matches just itself. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘(’.
The alternation operator is ‘|’.
The characters ‘^’ and ‘$’ always represent the beginning and end of a string respectively, except within square brackets. Within brackets, ‘^’ can be used to invert the membership of the character class being specified.
‘*’, ‘+’ and ‘?’ are special at any point in a regular expression except the following places, where they are not allowed:
Intervals are specified by ‘{’ and ‘}’. Invalid intervals are treated as literals, for example ‘a{1’ is treated as ‘a\{1’
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘posix-egrep’ regular expression syntax, Previous: ‘posix-awk’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
This is a synonym for ed.
Next: ‘posix-extended’ regular expression syntax, Previous: ‘posix-basic’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
This is a synonym for egrep.
Next: ‘posix-minimal-basic’ regular expression syntax, Previous: ‘posix-egrep’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character except the null character.
indicates that the regular expression should match one or more occurrences of the previous atom or regexp.
indicates that the regular expression should match zero or one occurrence of the previous atom or regexp.
matches a ‘+’
matches a ‘?’.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ is taken literally. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with parentheses ‘()’. An unmatched ‘)’ matches just itself. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘(’.
The alternation operator is ‘|’.
The characters ‘^’ and ‘$’ always represent the beginning and end of a string respectively, except within square brackets. Within brackets, ‘^’ can be used to invert the membership of the character class being specified.
‘*’, ‘+’ and ‘?’ are special at any point in a regular expression except the following places, where they are not allowed:
Intervals are specified by ‘{’ and ‘}’. Invalid intervals such as ‘a{1z’ are not accepted.
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Next: ‘sed’ regular expression syntax, Previous: ‘posix-extended’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
The character ‘.’ matches any single character except the null character.
Bracket expressions are used to match ranges of characters. Bracket expressions where the range is backward, for example ‘[z-a]’, are invalid. Within square brackets, ‘\’ is taken literally. Character classes are supported; for example ‘[[:digit:]]’ will match a single decimal digit.
GNU extensions are supported:
Grouping is performed with backslashes followed by parentheses ‘\(’, ‘\)’. A backslash followed by a digit acts as a back-reference and matches the same thing as the previous grouped expression indicated by that number. For example ‘\2’ matches the second group expression. The order of group expressions is determined by the position of their opening parenthesis ‘\(’.
The character ‘^’ only represents the beginning of a string when it appears:
The character ‘$’ only represents the end of a string when it appears:
Intervals are specified by ‘\{’ and ‘\}’. Invalid intervals such as ‘a\{1z’ are not accepted.
The longest possible match is returned; this applies to the regular expression as a whole and (subject to this constraint) to subexpressions within groups.
Previous: ‘posix-minimal-basic’ regular expression syntax, Up: Regular expression syntaxes [Contents][Index]
This is a synonym for ed.
Next: GNU Free Documentation License, Previous: Regular expressions, Up: GNU Gnulib [Contents][Index]
Gnulib has a couple of modules that don’t provide code, but rather extend the GNU Build System. That is, they are convenience facilities for use with GNU Automake (in particular).
Next: Controlling the Exported Symbols of Shared Libraries, Up: Build Infrastructure Modules [Contents][Index]
The following macros check for the presence or location of certain C, C++, or Fortran library archive files.
The macros AC_CHECK_LIB, AC_SEARCH_LIBS from GNU Autoconf check
for the presence of certain C, C++, or Fortran library archive files.
The libraries are looked up in the default linker path—a system dependent
list of directories, that usually contains the /usr/lib directory—and
those directories given by -L options in the LDFLAGS
variable.
The following macros, defined in the Gnulib module havelib, search for
the location of certain C, C++, or Fortran library archive files and make the
found location available to the compilation process and to further Autoconf
tests.
AC_LIB_LINKFLAGS(name, [dependencies]) ¶Searches for lib<name> and the libraries corresponding to
explicit and implicit dependencies. Sets and AC_SUBSTs the
LIB<NAME> and LTLIB<NAME> variables (with
<NAME> in upper case) and augments the CPPFLAGS variable
by -I options.
This macro should be used when lib<name> is expected to be found.
AC_LIB_HAVE_LINKFLAGS(name, [dependencies], [includes], [testcode], [missing-message]) ¶Searches for lib<name> and the libraries corresponding to
explicit and implicit dependencies, together with the specified include files
and the ability to compile and link the specified testcode. The
missing-message defaults to no and may contain additional hints
for the user. If found, it sets and AC_SUBSTs HAVE_LIB<NAME>=yes
and the LIB<NAME> and LTLIB<NAME> variables (with
<NAME> in upper case) and augments the CPPFLAGS variable
by -I options, and #defines HAVE_LIB<NAME> to 1.
Otherwise, it sets and AC_SUBSTs HAVE_LIB<NAME>=no and
LIB<NAME> and LTLIB<NAME> to empty.
These macros assume that when a library is installed in
some_directory/lib, its include files are installed in
some_directory/include.
The complexities that AC_LIB_LINKFLAGS and AC_LIB_HAVE_LINKFLAGS
deal with are the following:
CPPFLAGS for
the include file search path, LDFLAGS for the library search path).
The macro provides a ‘--with-lib<name>’ option. The user of the
‘configure’ script can use this option to indicate the location of the
library and its include files. If not provided, the --prefix directory
is searched as well.
LD_LIBRARY_PATH, the macro adds the appropriate run time search path
options to the LIB<NAME> variable. This works on most systems.
It can also be inhibited: The user of ‘configure’ can use the
--disable-rpath option to force an installation that doesn’t contain
hardcoded library search paths but instead may require the use of an
environment variable like LD_LIBRARY_PATH.
The macros also set a variable LTLIB<NAME>, that should be used
when linking with libtool. Both LTLIB<NAME> and
LIB<NAME> contain essentially the same option, but where
LIB<NAME> contains platform dependent flags like
‘-Wl,-rpath’, LTLIB<NAME> contains platform independent
flags like ‘-R’.
AC_LIB_LINKFLAGSCPPFLAGS vs. LDFLAGSAC_LIB_LINKFLAGSSuppose you want to use libz, the compression library.
AC_CONFIG_AUX_DIR([build-aux]) AC_LIB_LINKFLAGS([z])
Note that since the AC_LIB_LINKFLAGS invocation modifies the CPPFLAGS,
it should precede all tests that check for header files, declarations,
structures or types.
havelib module.
(gnulib-tool will usually do this for you automatically.)
Makefile.in you add @LIBZ@ to the link command line of
your program. Or, if you are using Automake, you add $(LIBZ) to the
LDADD variable that corresponds to your program.
The dependencies list is a space separated list of library names that
libname is known to depend upon. Example: If libfooy
depends on libfoox, and libfooz depends on libfoox and
libfooy, you can write:
AC_LIB_LINKFLAGS([foox]) AC_LIB_LINKFLAGS([fooy], [foox]) AC_LIB_LINKFLAGS([fooz], [foox fooy])
Explicit dependencies are necessary if you cannot assume that a .la
file, created by libtool, is installed. If you can assume that
libfooy.la is installed by libtool (and has not been omitted by the
package distributor!), you can omit the explicit dependency and just write
AC_LIB_LINKFLAGS([fooy])
This way, you don’t need to know in advance which libraries the needed library depends upon.
CPPFLAGS vs. LDFLAGSThe macros determine the directories that should be added to the compiler
preprocessor’s search path and to the linker’s search path. For the
compiler preprocessor, -I options with the necessary directories are
added to the CPPFLAGS variable, for use by the whole package. For
the linker, appropriate options are added to the LIB<NAME> and
LTLIB<NAME> variables, for use during linking by those programs
and libraries that need the dependency on lib<name>. You need
to use the value of LIB<NAME> or LTLIB<NAME> in the
Makefiles. LTLIB<NAME> is for use with libtool, whereas
LIB<NAME> is for when libtool is not involved in linking.
The macros do not check whether the include files and the library found match. If you want to verify this at configure time, one technique is to have a version number in the include files and a version number in the library, like this:
#define LIBNAME_VERSION 10203 extern int libname_version; /* initialized to LIBNAME_VERSION */
and use a test like
AC_TRY_RUN([int main () { return libname_version != LIBNAME_VERSION; }])
A bi-arch system is one where
On several types of such systems, for historical reasons, the 32-bit libraries are installed in prefix/lib, whereas the 64-bit libraries are installed in
On such systems, in 64-bit mode, configure will search for the
libraries in prefix/lib64 or prefix/lib/64,
respectively, not in prefix/lib. A user can adhere to these
system-wide conventions by using the ‘--libdir’ option when installing
packages. When a user has already installed packages in 64-bit mode using
the GNU default ‘--libdir=prefix/lib’, he can make this directory
adhere to the system-wide convention by placing a symbolic link:
ln -s lib prefix/lib64
ln -s . prefix/lib/64
Next: Visual Studio Compatibility, Previous: Controlling the Exported Symbols of Shared Libraries, Up: Build Infrastructure Modules [Contents][Index]
The lib-symbol-versions module can be used to add shared
library versioning support. Currently, only GNU LD and the Solaris
linker supports this.
Version scripts provides information that can be used by GNU/Linux
distribution packaging tools. For example, Debian has a tool
dpkg-shlibdeps that can determine the minimal required version
of each dependency (by looking at the symbol list) and stuff the
information into the Debian specific packaging files.
For more information and other uses of version scripts, see Ulrich Drepper’s paper https://www.akkadia.org/drepper/dsohowto.pdf
You use the module by importing it to your library, and then add the
following lines to the Makefile.am that builds the library:
if HAVE_LD_VERSION_SCRIPT libfoo_la_LDFLAGS += -Wl,--version-script=$(srcdir)/libfoo.map endif
The version script file format is documented in the GNU LD manual, but a small example would be:
LIBFOO_1.0 {
global:
libfoo_init; libfoo_doit; libfoo_done;
local:
*;
};
If you target platforms that do not support linker scripts (i.e., all
platforms that doesn’t use GNU LD) you may want to consider a more
portable but less powerful alternative: libtool
-export-symbols. It will hide internal symbols from your
library, but will not add ELF versioning symbols. Your usage would
then be something like:
if HAVE_LD_VERSION_SCRIPT libfoo_la_LDFLAGS += -Wl,--version-script=$(srcdir)/libfoo.map else libfoo_la_LDFLAGS += -export-symbols $(srcdir)/libfoo.sym endif
See the Libtool manual for the file syntax, but a small example would be:
libfoo_init libfoo_doit libfoo_done
To avoid the need for a *.sym file if your symbols are easily
expressed using a regular expression, you may use
-export-symbols-regex:
if HAVE_LD_VERSION_SCRIPT libfoo_la_LDFLAGS += -Wl,--version-script=$(srcdir)/libfoo.map else libfoo_la_LDFLAGS += -export-symbols-regex '^libfoo_.*' endif
For more discussions about symbol visibility, rather than shared
library versioning, see the visibility module
(see Controlling the Exported Symbols of Shared Libraries).
Next: configmake, Previous: LD Version Scripts, Up: Build Infrastructure Modules [Contents][Index]
The lib-msvc-compat module detects whether the linker supports
--output-def when building a library. That parameter is used
to generate a DEF file for a shared library (DLL). DEF files are
useful for developers that use Visual Studio to develop programs that
links to your library. See the GNU LD manual for more information.
There are other ways to create a DEF file, but we believe they are all
sub-optimal to using --output-def during the build process.
The variants we have considered include:
$ { echo EXPORTS; \
dumpbin /EXPORTS libfoo-0.dll | tail -n+20 | awk '{ print $4 }'; \
} > libfoo-0.def
$ lib /def:libfoo-0.def
If you are using libtool to build your shared library, here is how to
use this module. Import lib-msvc-compat to your project, and
then add the following lines to the Makefile.am that builds the
library:
if HAVE_LD_OUTPUT_DEF libfoo_la_LDFLAGS += -Wl,--output-def,libfoo-$(DLL_VERSION).def defexecdir = $(bindir) defexec_DATA = libfoo-$(DLL_VERSION).def DISTCLEANFILES += $(defexec_DATA) endif
The DLL_VERSION variable needs to be defined. It should be the
shared library version number used in the DLL filename. For Windows
targets you compute this value from the values you pass to Libtool’s
-version-info. Assuming you have variables LT_CURRENT
and LT_AGE defined for the CURRENT and AGE
libtool version integers, you compute DLL_VERSION as follows:
DLL_VERSION=`expr ${LT_CURRENT} - ${LT_AGE}`
AC_SUBST(DLL_VERSION)
Next: warnings, Previous: Visual Studio Compatibility, Up: Build Infrastructure Modules [Contents][Index]
The configmake module builds a C include file named
configmake.h containing the usual installation directory
values; for example, those specified by --prefix or
--libdir to configure. Each variable is given a #define
with an all-uppercase macro name, such as PREFIX and
LIBDIR. (Automake cannot create this file directly because the
user might override directory values at make time.)
Specifically, the module retrieves values of the variables through
configure followed by make, not directly through
configure, so that a user who sets some of these variables
consistently on the make command line gets correct results.
One advantage of this approach, compared to the classical approach of
adding -DLIBDIR=\"$(libdir)\" etc. to AM_CPPFLAGS, is
that it protects against the use of undefined variables. That is, if,
say, $(libdir) is not set in the Makefile, LIBDIR is not
defined by this module, and code using LIBDIR gives a
compilation error.
Another advantage is that make output is shorter.
For the complete list of variables which are #defined this way,
see the file gnulib/modules/configmake, or inspect your
resulting gnulib Makefile.
Next: manywarnings, Previous: configmake, Up: Build Infrastructure Modules [Contents][Index]
The warnings module allows to regularly build a package with more
GCC warnings than the default warnings emitted by GCC.
It provides the following functionality:
CFLAGS variable at configuration time.
CFLAGS does not work in general, because it may
break autoconfiguration.)
configure with an option such as
--enable-gcc-warnings.
To use this module, you need the following:
gl_WARN_ADD([-Wall], [WARN_CFLAGS]) gl_WARN_ADD([-Wpointer-arith], [WARN_CFLAGS])
WARN_CFLAGS, use it in the
definition of AM_CFLAGS, like this:
AM_CFLAGS = $(WARN_CFLAGS)
Note that the AM_CFLAGS is used in combination with CFLAGS
and before CFLAGS in build rules emitted by Automake. This allows
the user to provide CFLAGS that override the WARN_CFLAGS.
‘gl_WARN_ADD([-Werror])’ is intended for developers, and should be avoided in contexts where it would affect ordinary installation builds. The warnings emitted by GCC depend, to some extent, on the contents of the system header files, on the size and signedness of built-in types, etc. Use of ‘-Werror’ would cause frustration to all users on platforms that the maintainer has not tested before the release. It is better if ‘-Werror’ is off by default, and is enabled only by developers. For example, ‘-Werror’ could affect ‘make distcheck’ or ‘configure --enable-gcc-warnings’ as mentioned above.
Previous: warnings, Up: Build Infrastructure Modules [Contents][Index]
The manywarnings module allows you to enable as many GCC warnings as
possible for your package. The purpose is to protect against introducing new
code that triggers warnings that weren’t already triggered by the existing code
base.
An example use of the module is as follows:
gl_MANYWARN_ALL_GCC([warnings]) # Set up the list of the pointless, undesired warnings. nw= nw="$nw -Wsystem-headers" # Don't let system headers trigger warnings nw="$nw -Wundef" # All compiler preprocessors support #if UNDEF nw="$nw -Wtraditional" # All compilers nowadays support ANSI C nw="$nw -Wconversion" # These warnings usually don't point to mistakes. nw="$nw -Wsign-conversion" # Likewise. # Enable all GCC warnings not in this list. gl_MANYWARN_COMPLEMENT([warnings], [$warnings], [$nw]) for w in $warnings; do gl_WARN_ADD([$w]) done
This module is meant to be used by developers who are not very experienced
regarding the various GCC warning options. In the beginning you will set the
list of undesired warnings (‘nw’ in the example above) to empty, and
compile the package with all possible warnings enabled. The GCC option
-fdiagnostics-show-option, available in GCC 4.1 or newer, helps
understanding which warnings originated from which option. Then you will
go through the list of warnings. You will likely deactivate warnings that
occur often and don’t point to mistakes in the code, by adding them to the
‘nw’ variable, then reconfiguring and recompiling. When warnings point
to real mistakes and bugs in the code, you will of course not disable
them.
There are also many GCC warning options which usually don’t point to mistakes in the code; these warnings enforce a certain programming style. It is a project management decision whether you want your code to follow any of these styles. Note that some of these programming styles are conflicting. You cannot have them all; you have to choose among them.
When a new version of GCC is released, you can add the new warning options
that it introduces into the gl_MANYWARN_ALL_GCC macro (and submit your
modification to the Gnulib maintainers :-)), and enjoy the benefits of the
new warnings, while adding the undesired ones to the ‘nw’ variable.
Next: Index, Previous: Build Infrastructure Modules, Up: GNU Gnulib [Contents][Index]
Copyright © 2000, 2001, 2002, 2007, 2008 Free Software Foundation, Inc. https://fsf.org/ Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed.
The purpose of this License is to make a manual, textbook, or other functional and useful document free in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others.
This License is a kind of “copyleft”, which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software.
We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference.
This License applies to any manual or other work, in any medium, that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. Such a notice grants a world-wide, royalty-free license, unlimited in duration, to use that work under the conditions stated herein. The “Document”, below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as “you”. You accept the license if you copy, modify or distribute the work in a way requiring permission under copyright law.
A “Modified Version” of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language.
A “Secondary Section” is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document’s overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (Thus, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them.
The “Invariant Sections” are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. If a section does not fit the above definition of Secondary then it is not allowed to be designated as Invariant. The Document may contain zero Invariant Sections. If the Document does not identify any Invariant Sections then there are none.
The “Cover Texts” are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A Front-Cover Text may be at most 5 words, and a Back-Cover Text may be at most 25 words.
A “Transparent” copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, that is suitable for revising the document straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup, or absence of markup, has been arranged to thwart or discourage subsequent modification by readers is not Transparent. An image format is not Transparent if used for any substantial amount of text. A copy that is not “Transparent” is called “Opaque”.
Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML, PostScript or PDF designed for human modification. Examples of transparent image formats include PNG, XCF and JPG. Opaque formats include proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML, PostScript or PDF produced by some word processors for output purposes only.
The “Title Page” means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, “Title Page” means the text near the most prominent appearance of the work’s title, preceding the beginning of the body of the text.
The “publisher” means any person or entity that distributes copies of the Document to the public.
A section “Entitled XYZ” means a named subunit of the Document whose title either is precisely XYZ or contains XYZ in parentheses following text that translates XYZ in another language. (Here XYZ stands for a specific section name mentioned below, such as “Acknowledgements”, “Dedications”, “Endorsements”, or “History”.) To “Preserve the Title” of such a section when you modify the Document means that it remains a section “Entitled XYZ” according to this definition.
The Document may include Warranty Disclaimers next to the notice which states that this License applies to the Document. These Warranty Disclaimers are considered to be included by reference in this License, but only as regards disclaiming warranties: any other implication that these Warranty Disclaimers may have is void and has no effect on the meaning of this License.
You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3.
You may also lend copies, under the same conditions stated above, and you may publicly display copies.
If you publish printed copies (or copies in media that commonly have printed covers) of the Document, numbering more than 100, and the Document’s license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects.
If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages.
If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a computer-network location from which the general network-using public has access to download using public-standard network protocols a complete Transparent copy of the Document, free of added material. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public.
It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document.
You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version:
If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version’s license notice. These titles must be distinct from any other section titles.
You may add a section Entitled “Endorsements”, provided it contains nothing but endorsements of your Modified Version by various parties—for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard.
You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one.
The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version.
You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice, and that you preserve all their Warranty Disclaimers.
The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work.
In the combination, you must combine any sections Entitled “History” in the various original documents, forming one section Entitled “History”; likewise combine any sections Entitled “Acknowledgements”, and any sections Entitled “Dedications”. You must delete all sections Entitled “Endorsements.”
You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects.
You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document.
A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, is called an “aggregate” if the copyright resulting from the compilation is not used to limit the legal rights of the compilation’s users beyond what the individual works permit. When the Document is included in an aggregate, this License does not apply to the other works in the aggregate which are not themselves derivative works of the Document.
If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one half of the entire aggregate, the Document’s Cover Texts may be placed on covers that bracket the Document within the aggregate, or the electronic equivalent of covers if the Document is in electronic form. Otherwise they must appear on printed covers that bracket the whole aggregate.
Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License, and all the license notices in the Document, and any Warranty Disclaimers, provided that you also include the original English version of this License and the original versions of those notices and disclaimers. In case of a disagreement between the translation and the original version of this License or a notice or disclaimer, the original version will prevail.
If a section in the Document is Entitled “Acknowledgements”, “Dedications”, or “History”, the requirement (section 4) to Preserve its Title (section 1) will typically require changing the actual title.
You may not copy, modify, sublicense, or distribute the Document except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, or distribute it is void, and will automatically terminate your rights under this License.
However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation.
Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice.
Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, receipt of a copy of some or all of the same material does not give you any rights to use it.
The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See https://www.gnu.org/licenses/.
Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License “or any later version” applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. If the Document specifies that a proxy can decide which future versions of this License can be used, that proxy’s public statement of acceptance of a version permanently authorizes you to choose that version for the Document.
“Massive Multiauthor Collaboration Site” (or “MMC Site”) means any World Wide Web server that publishes copyrightable works and also provides prominent facilities for anybody to edit those works. A public wiki that anybody can edit is an example of such a server. A “Massive Multiauthor Collaboration” (or “MMC”) contained in the site means any set of copyrightable works thus published on the MMC site.
“CC-BY-SA” means the Creative Commons Attribution-Share Alike 3.0 license published by Creative Commons Corporation, a not-for-profit corporation with a principal place of business in San Francisco, California, as well as future copyleft versions of that license published by that same organization.
“Incorporate” means to publish or republish a Document, in whole or in part, as part of another Document.
An MMC is “eligible for relicensing” if it is licensed under this License, and if all works that were first published under this License somewhere other than this MMC, and subsequently incorporated in whole or in part into the MMC, (1) had no cover texts or invariant sections, and (2) were thus incorporated prior to November 1, 2008.
The operator of an MMC Site may republish an MMC contained in the site under CC-BY-SA on the same site at any time before August 1, 2009, provided the MMC is eligible for relicensing.
To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page:
Copyright (C) year your name. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.3 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled ``GNU Free Documentation License''.
If you have Invariant Sections, Front-Cover Texts and Back-Cover Texts, replace the “with…Texts.” line with this:
with the Invariant Sections being list their titles, with
the Front-Cover Texts being list, and with the Back-Cover Texts
being list.
If you have Invariant Sections without Cover Texts, or some other combination of the three, merge those two alternatives to suit the situation.
If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.
Previous: GNU Free Documentation License, Up: GNU Gnulib [Contents][Index]
| Jump to: | $
(
)
*
+
-
.
=
?
[
\
]
^
_
{
|
}
A B C D E F G H I J K L M N O P Q R S T U V W X Y |
|---|
| Jump to: | $
(
)
*
+
-
.
=
?
[
\
]
^
_
{
|
}
A B C D E F G H I J K L M N O P Q R S T U V W X Y |
|---|
Sometimes
you don’t have to explicitly quote special characters to make
them ordinary. For instance, most characters lose any special meaning
inside a list (see List Operators ([ … ] and [^ … ])). In addition, if the syntax bits
RE_CONTEXT_INVALID_OPS and RE_CONTEXT_INDEP_OPS
aren’t set, then (for historical reasons) the matcher considers special
characters ordinary if they are in contexts where the operations they
represent make no sense; for example, then the match-zero-or-more
operator (represented by ‘*’) matches itself in the regular
expression ‘*foo’ because there is no preceding expression on which
it can operate. It is poor practice, however, to depend on this
behavior; if you want a special character to be ordinary outside a list,
it’s better to always quote it, regardless.
Regex therefore doesn’t consider the ‘^’ to be the first character in the list. If you put a ‘^’ character first in (what you think is) a matching list, you’ll turn it into a nonmatching list.
You can’t use a character class for the starting or ending point of a range, since a character class is not a single character.
Regular expressions are also referred to as “patterns,” hence the name “pattern buffer.”
A table that maps all uppercase letters to the corresponding lowercase ones would work just as well for this purpose.